HiSeq10 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10
Unique NameHiSeq10
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length758
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10HiSeq10_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10 ID=HiSeq10|Name=HiSeq10|organism=Ostrinia scapulalis|type=mRNA|length=758bp
AACATCATTCAGCCGCAACATCGTCACCCCTTGGAAGGAGAACATCTCTC
TCTCCTGTAACAAAGTTGGCGTGCCCACACCTTCTACCACTTGGAGCATG
AATGGCGCTACTTTGGAATCCACACTGAGGAAGAACGTTAGCAACGATGG
GACTCTTGTTATTAGCATGACTCAATACGCCGATAGTGGCAACTACACCT
GTTCAGTTGAGAACATCCACGGACGTGACGAGGTCACCTACAGCGTGGAA
GTGAAGGTTCCACCTCAGCCACCTGTCCTGGCCGTGGTAGATTCGTATGC
CGACTCCTTACATCTACAATGGAGCGACCAGGGCGATGGGGGCAGTCCTA
TTCTTGGATACGTAATAAATTACAAACGCGAGCACGGCGACTGGGAGGAG
TTGCAAGTGGAAGCGGGCACTTCGGAGCACGTGTTGCCGAACCTTTGGTG
CGGGACCCGCTACCAACTGTACATTACCGCCTTCAATAGGATCGGCACTG
GACTGCCGTGTGACATCGTTCATGCTTACACTAAAGGCACTGTCCCAGTG
AAACCCAAACATTCCCAAATGATAACACTAAACACAACGACGGTAACCGT
GTGGTTGGACTCATGGGGAGACGGCGGCTGCGGCATTCTCTACTTTGTCA
TCGAGTATAGAGAGATCAGTCAATCGCAGTGGCGTCTAGTATCGAACAGC
GTGCAGGCCACGGAGCGAGTCTTCAGCGTGCCCGGCCTGACGCCCGCCGC
GCACTACC
back to top

protein sequence of HiSeq10

>HiSeq10_p ID=HiSeq10_p|Name=HiSeq10|organism=Ostrinia scapulalis|type=polypeptide|length=252bp
TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDG
TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYA
DSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWC
GTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTV
WLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAA
HY
back to top