HiSeq1000 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq1000
Unique NameHiSeq1000
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length210
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq1000HiSeq1000_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq1000 ID=HiSeq1000|Name=HiSeq1000|organism=Ostrinia scapulalis|type=mRNA|length=210bp
GACGTTAACGTGCGAGCTGTGGTTCAACAACAGTACGAATCTGAAGTAAA
CAACGAATACGTAATTCGCGGTAACTCCGCTATCCTCAAATGCTCTATCC
CGTCTTTTGTCGCGGATTTTGTTACTGTGGTCTCCTGGCATGACGAAGAA
GGCAATTCCATTGCTCTTGATGGATCCAAAGCAGGAGACGACGGAAAGTA
CTTGGTTTTA
back to top

protein sequence of HiSeq1000

>HiSeq1000_p ID=HiSeq1000_p|Name=HiSeq1000|organism=Ostrinia scapulalis|type=polypeptide|length=70bp
DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEE
GNSIALDGSKAGDDGKYLVL
back to top