HiSeq10001 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10001
Unique NameHiSeq10001
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1474
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10001HiSeq10001_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10001 ID=HiSeq10001|Name=HiSeq10001|organism=Ostrinia scapulalis|type=mRNA|length=1474bp
ACTTTTTAGTGCAGGTTTTTTGGATTCGGTTTTAATTTTTTTGTTAATTC
AAGAAAGTAAGAACTTTTACGTTTATATCATCTGAAACGATTTACCATCA
TTTAGTAGAAATAAATAGAGAAAAATAGCATAACATAAACTTTCATAAAT
AACATTTAAAAAGTTGCGTATCATAGCGCACGCGCATACGGTGACGTAAT
TGACGTAATCTTTATGCCATTAATTAATCGAAGCGATACAATTAATAATT
ACTCTGAATTAGCAAATGACCCTAAGATTTGGGTATTTAAACCACCTTCA
CAGTATGAAGTTCATCATTCGAACATTGAACTAGTTCAATAAACATTCAA
AACTTCTTCAAACTTATAAACCTATATCAAAATGTTCAAGGCAGTATTTG
TCTGTGTAATCCTCATTGTCGCTACTTCAGCAACGCATTATGAAGACCTA
GAATTGAATAATCTGATTGAGTACGGAGAGTCACCTTATGGGGTAAGTTA
AATATCACTTTCTTCAGTTCAGGCATTTGGTCTCTACTGAAGGAGTACGA
CCCTCTCTGATGTTCCAGAGGCTAATGGAGGATTTAGCTTACACCTCACC
ACACCAGCCAGAAGTCAAAATATTGTAAAAGCCATCATTTGATCGTCAGT
TATCAATCATTCTTTTTCTTATTTGGTTTATGGCCAGATCTGGGTCTCTT
TTGTAGTTCTTTGGGCTATATCATTTCTTGCACCATATTCTTAGCTTCAA
ACATCATACTAATCAAATTTTTTTTCAGGGCTTCGTTGTGCCGTACCCTT
ATCAAGATCAATTACAAGAACAAGTGGTGTTAAAACCTCTTTATTCTGAA
GTCATCGTGCCTGCAGTGCCAGCGCTTCCAGCCACTGCAGTAGTGTCTGA
AGTAGCTGAAGTCGGCTTCTCAAAGCTTGGTCTCATCACAAAAGCGGCAT
CTTTCGCACTTGGTTTGGTGAAGACAGCCGTCTTCTTCGTCATCGCCAAA
GCCCCTGCTCTTATCCTGGGAACGTTGGCTGCCTTCGGAATCTGCAAGTT
CACGCCTATCTGCTCCAAGCTCTCCAGCGTGGAGTCTTTGTACGAAGTCC
CTATTGAGCTCAGGTCATACGCTACCCCTGAGAGGCTGGCCAAGGCGACC
GAGTTCGTCAAGAAGGCGATTAGGAAGTACCGGTCATTGCAAGAGGAACA
CTGAAGGCGATTGTAGATTAATTTATATTTATAGTTACGAGTATTTAAGA
CTATTTATTTGATGAAATAAATTATTGAAACGAAACTTTTGATTCTTTTC
TTCAACTTAACCTGTACGGTAGCTTTGATAGACAAATGCTCCGTTAAGTA
ATACTCGTCGAGACGAGTGATGAACAATTTACATGCAAAAAGTCTAAAAT
AATCATAATTTTGTTAAAATTAATAAATTAATAATGTAACAAAAAATATA
CACATACATAGAAATATGTATATA
back to top

protein sequence of HiSeq10001

>HiSeq10001_p ID=HiSeq10001_p|Name=HiSeq10001|organism=Ostrinia scapulalis|type=polypeptide|length=175bp
MARSGSLXVVLWAISFLAXXILSFKHHTNQIFFQGFVVPYPYQDQLQEQV
VLKPLYSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGLVKT
AVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYAT
PERLAKATEFVKKAIRKYRSLQEEH
back to top