HiSeq10002 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10002
Unique NameHiSeq10002
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1188
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10002HiSeq10002_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10002 ID=HiSeq10002|Name=HiSeq10002|organism=Ostrinia scapulalis|type=mRNA|length=1188bp
ACTTTTTAGTGCAGGTTTTTTGGATTCGGTTTTAATTTTTTTGTTAATTC
AAGAAAGTAAGAACTTTTACGTTTATATCATCTGAAACGATTTACCATCA
TTTAGTAGAAATAAATAGAGAAAAATAGCATAACATAAACTTTCATAAAT
AACATTTAAAAAGTTGCGTATCATAGCGCACGCGCATACGGTGACGTAAT
TGACGTAATCTTTATGCCATTAATTAATCGAAGCGATACAATTAATAATT
ACTCTGAATTAGCAAATGACCCTAAGATTTGGGTATTTAAACCACCTTCA
CAGTATGAAGTTCATCATTCGAACATTGAACTAGTTCAATAAACATTCAA
AACTTCTTCAAACTTATAAACCTATATCAAAATGTTCAAGGCAGTATTTG
TCTGTGTAATCCTCATTGTCGCTACTTCAGCAACGCATTATGAAGACCTA
GAATTGAATAATCTGATTGAGTACGGAGAGTCACCTTATGGGGGCTTCGT
TGTGCCGTACCCTTATCAAGATCAATTACAAGAACAAGTGGTGTTAAAAC
CTCTTTATTCTGAAGTCATCGTGCCTGCAGTGCCAGCGCTTCCAGCCACT
GCAGTAGTGTCTGAAGTAGCTGAAGTCGGCTTCTCAAAGCTTGGTCTCAT
CACAAAAGCGGCATCTTTCGCACTTGGTTTGGTGAAGACAGCCGTCTTCT
TCGTCATCGCCAAAGCCCCTGCTCTTATCCTGGGAACGTTGGCTGCCTTC
GGAATCTGCAAGTTCACGCCTATCTGCTCCAAGCTCTCCAGCGTGGAGTC
TTTGTACGAAGTCCCTATTGAGCTCAGGTCATACGCTACCCCTGAGAGGC
TGGCCAAGGCGACCGAGTTCGTCAAGAAGGCGATTAGGAAGTACCGGTCA
TTGCAAGAGGAACACTGAAGGCGATTGTAGATTAATTTATATTTATAGTT
ACGAGTATTTAAGACTATTTATTTGATGAAATAAATTATTGAAACGAAAC
TTTTGATTCTTTTCTTCAACTTAACCTGTACGGTAGCTTTGATAGACAAA
TGCTCCGTTAAGTAATACTCGTCGAGACGAGTGATGAACAATTTACATGC
AAAAAGTCTAAAATAATCATAATTTTGTTAAAATTAATAAATTAATAATG
TAACAAAAAATATACACATACATAGAAATATGTATATA
back to top

protein sequence of HiSeq10002

>HiSeq10002_p ID=HiSeq10002_p|Name=HiSeq10002|organism=Ostrinia scapulalis|type=polypeptide|length=178bp
MFKAVFVCVILIVATSATHYEDLELNNLIEYGESPYGGFVVPYPYQDQLQ
EQVVLKPLYSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGL
VKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRS
YATPERLAKATEFVKKAIRKYRSLQEEH
back to top