HiSeq10003 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10003
Unique NameHiSeq10003
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1175
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10003HiSeq10003_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10003 ID=HiSeq10003|Name=HiSeq10003|organism=Ostrinia scapulalis|type=mRNA|length=1175bp
CAGTATTTCATTTATTATGGCCTTATTATTAATATCACAAGATAAATGCA
CAAATTCATATTATTTTAGTCTCGTTTACATTTCAATTAATTTTTAATTT
GATAATAACATTTTTTTTGGAAATGTAAATTAGATATAAAGTCAAGTTCT
GTAAATGTCGCTATAGATACATGTTCAAAACCTTGACAACACTTGTTTCT
GATTGGGGCTCGATTGAATCATTTCCCGCGTCCCCCGCAGCCCGGCTTGC
CCCCGGGCGGCGGGCGGCAGATGGTCTTCTTGTTGCACGCGCTCGCGGCC
GCCACCAGCCACACCAGCCACCACCACACCGCCCACGCCGACCACGCTCG
AGACACCGGCTCCATAATAGCTAGTCGGGGCAGGCTGGTCGCTCCTACCA
GTACTTGGGCTTGCAGCCGCCCGGGCAGCGCGGCGGACGGCACGACGACT
TCTTCTTGCACGCGAGGGCGCCGACCACCTGTATCAGTAGACAAAGCAGC
AACCAGAGTCCGGTCTGTGAATACTTCATATTTGCTGAGTACTTAGAGAT
CTCCCATGGGCACCTCACTACATGTTGTTGTTATTAGTTTTGTATTTAGC
AGGTAATTTTGCTGGTGACATGGCCGAAAATTTCAATTGTTCTGTTTCTG
ACTTGCTGTCAAAGCTGATACTTTTTTTTGTGAGGTGCCAGTTCTGAGAG
GAGCTGTCATTCTTCTGTGAAGTTTGGTTGTGCTGTTCGTAAAGAGGTTT
GCACATTGCAGCTTCTGCAATAACGCCGTTGAGTTTTGTTTATTTTCGCT
GCTTCTTCTGAGACAGGCATAGAGGCGGGCTACTACGTAGCTTGCCTAAC
AATAAGCTACCTTTCCCTAATAGTCCTCATCTTGTTGAGCTGTATGTGCT
CAAACCCAGAATACACAGCCCTGTCTATTTTTAATACCATGACCGGACTG
GGCTCGAACCTGAGGTAATAAGATTCACCATCATGTGGATATCTTATGGC
CATTAAAAAACAATAGGTACTTAGGTACTTTTTATTAAATATCTAGTTAA
CTACGATAAAAGATAAAAGTTTGCCCTAGATCTAGCTTACTAAGTAATGT
GAAAATCTAAGGCCAGAATCTTTCACTTGAGAGGATAATTCTAATCTATG
AACCTCATTTCCATCATACCGATGA
back to top

protein sequence of HiSeq10003

>HiSeq10003_p ID=HiSeq10003_p|Name=HiSeq10003|organism=Ostrinia scapulalis|type=polypeptide|length=62bp
MCKPLYEQHNQTSQKNDSSSQNWHLTKKSISFDSKSETEQLKFSAMSPAK
LPAKYKTNNNNM
back to top