HiSeq10006 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10006
Unique NameHiSeq10006
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length417
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10006HiSeq10006_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10006 ID=HiSeq10006|Name=HiSeq10006|organism=Ostrinia scapulalis|type=mRNA|length=417bp
AATTATACTTATTATACTTACAAACACTTGGAGACAATAGTACGTTTAGA
CCGTTCAAGGTAGATCTAGTATCGAGAATGTTATGCGTTGTTAATGGTTG
AGAATTGGGCATTATTGTAGATGGGTAAGGTGAAGTTTTTGCGTATTCTA
GTGGTGATACAGATTTTTGAGTAGAATATTCTGAGGGAGTGCATATTTTT
GGAATATCTGGATAGTAAAGGGTAGGTCTACCACCGGGTGTGTTAGGAGT
GATTGCACTTGAAGGTAGAGAATTTGGCGAAGTTTCAGCGTTTAATTGTG
GCAAAATAGATTTTGGACTGGAATATTCAGAGGAAGGGAATACTTTAGGG
ATATCTAAAACGGTAGGAGTTTGAGGTGTCAAGTTTGAAGGGTTTTGGGT
ATAGTATGAAGACGATG
back to top

protein sequence of HiSeq10006

>HiSeq10006_p ID=HiSeq10006_p|Name=HiSeq10006|organism=Ostrinia scapulalis|type=polypeptide|length=138bp
SSSYYTQNPSNLTPQTPTVLDIPKVFPSSEYSSPKSILPQLNAETSPNSL
PSSAITPNTPGGRPTLYYPDIPKICTPSEYSTQKSVSPLEYAKTSPYPST
IMPNSQPLTTHNILDTRSTLNGLNVLLSPSVCKYNKYN
back to top