HiSeq10014 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10014
Unique NameHiSeq10014
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1458
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10014HiSeq10014_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10014 ID=HiSeq10014|Name=HiSeq10014|organism=Ostrinia scapulalis|type=mRNA|length=1458bp
CAAGCAGGAGGCGCGACAAAAAAAATTGTCAAAATTTTTGTTGTTGATAA
TGTGCAAAAAAATCATTGTAATTTTTATGTTTCGGAGAAATTTTATCTAA
GACTTAACATGCAGAGTCATGGAACCACGGCGGAAGATTCAAGCAGGACC
TATGGCTCCATCTAGCATGAAGTCTGCAAGGAAAAGCTTTGCAGTTACCA
ATACGTACATAAAAAGTAATGCTAGCGCGCCCCAAAAGGAAATTATAACC
GTACATACGAGCACTCCTCATGTAGAGAAAAGATCATTTCACGCTGAACA
AAATCAAGTATACCAGGGTGATGTAAATGTCCTTTCAATTATAGATACCA
ACAAAGATATAATGTGTTGTAAATATACGGAAGATGTCAACGACATTGCT
GCTGGCTTCACAGACGGCACCATCAGGCTTTTTGATTGCAATACCGGCAA
CTGCACACACACCCTGGTCGACGATGAGTGTCGAGCGTACCCAGGCCCTG
TTACCGCCATCAAACATCGCCCAGTGAGCAAAGCTCATCCTATAACAAAT
ATGCTGTTGTCATCGTATGTAAATGGATGCATAAAGTGCTGGAAATATAA
ATATGATCAATGCCTTTACACAATACGAGAAAAGCGACAGACTTTGGGAC
TGTGTTACCACCCACATTATACGAAATTTATAACCTACGGAGACGATGCC
AAGCTAAATATGTACGACGAGGAAGCACAGACGCAAGAAAGAGCATTTTA
TTCAAGTCAAAGAAAGAACATAGTAGACGGACACACATCAAGAATTTTTG
CGTGTGCGTTCAATCCTAAATCTCATCACGAGTTGATATCGGGCGGCTGG
GACAACACTGTTATGTGCTGGGATGATAGACAACCTTATGCGACTAGGTA
TTTTTTCGGTATACATATGTGCGGGGAGGGACTGGATTTTGATAAGCCAG
GAAAACAGATATTGACCTGCTCTTGGCAAGACAAAGAAAGTATTCAACTT
TGGGATTATGGGTCTTGTAAACTAATCGAAACAATAGTTCCTGACAATTA
CCAGTCAAAGCTGTATTGTGGCAAATTTGTCCCGAGAACCAATCTAATTG
TGTGCGGAGGGTCTGACTCGAATATGATGAGAGTTGTAGATATTAATCTG
AAGATAACAGAATGTTCAATTCGAAATAATCCTGGAGGGATATATGCATT
CGACTACGGCACAATTAGAAGGAAACCAAGAAAAGTGCCTGAAACATACA
AAAGGATAAGCGAAATTGAAAATACTCCAAGAGTCGCCTTTGTTACTGGC
AAAAGGCTGCAAACAGTTGATTTCGGATAATATTAAAAGTCTTAAAACTG
TAAAAATCTATTTATATAATATTTATAGCGTCAGATGTGTCTATTTTACT
TTAATTTATAATAAATCAATTTAATATGTATGTCACATTTTTATTCATCA
TTCATAAA
back to top

protein sequence of HiSeq10014

>HiSeq10014_p ID=HiSeq10014_p|Name=HiSeq10014|organism=Ostrinia scapulalis|type=polypeptide|length=403bp
MEPRRKIQAGPMAPSSMKSARKSFAVTNTYIKSNASAPQKEIITVHTSTP
HVEKRSFHAEQNQVYQGDVNVLSIIDTNKDIMCCKYTEDVNDIAAGFTDG
TIRLFDCNTGNCTHTLVDDECRAYPGPVTAIKHRPVSKAHPITNMLLSSY
VNGCIKCWKYKYDQCLYTIREKRQTLGLCYHPHYTKFITYGDDAKLNMYD
EEAQTQERAFYSSQRKNIVDGHTSRIFACAFNPKSHHELISGGWDNTVMC
WDDRQPYATRYFFGIHMCGEGLDFDKPGKQILTCSWQDKESIQLWDYGSC
KLIETIVPDNYQSKLYCGKFVPRTNLIVCGGSDSNMMRVVDINLKITECS
IRNNPGGIYAFDYGTIRRKPRKVPETYKRISEIENTPRVAFVTGKRLQTV
DFG
back to top