HiSeq10015 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10015
Unique NameHiSeq10015
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1397
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10015HiSeq10015_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10015 ID=HiSeq10015|Name=HiSeq10015|organism=Ostrinia scapulalis|type=mRNA|length=1397bp
CAAGCAGGAGGCGCGACAAAAAAAATTGTCAAAATTTTTGTTGTTGATAA
TGTGCAAAAAAATCATTGTAATTTTTATGTTTCGGAGAAATTTTATCTAA
GACTTAACATGCAGAGTCATGGAACCACGGCGGAAGATTCAAGCAGGACC
TATGGCTCCATCTAGCATGAAGTCTGCAAGGAAAAGCTTTGCAGTTACCA
ATACGTACATAAAAAGTAATGCTAGCGCGCCCCAAAAGGAAATTATAACC
GTACATACGAGCACTCCTCATGTAGAGAAAAGATCATTTCACGCTGAACA
AAATCAAGTATACCAGGGTGATGTAAATGTCCTTTCAATTATAGATACCA
ACAAAGATATAATGTGTTGTAAATATACGGAAGATGTCAACGACATTGCT
GCTGGCTTCACAGACGGCACCATCAGGCTTTTTGATTGCAATACCGGCAA
CTGCACACACACCCTGGTCGACGATGAGTGTCGAGCGTACCCAGGCCCTG
TTACCGCCATCAAACATCGCCCAGTGAGCAAAGCTCATCCTATAACAAAT
ATGCTGTTGTCATCGTATGTAAATGGATGCATAAAGTGCTGGAAATATAA
ATATGATCAATGCCTTTACACAATACGAGAAAAGCGACAGACTTTGGGAC
TGTGTTACCACCCACATTATACGAAATTTATAACCTACGGAGACGATGCC
AAGCTAAATATGTACGACGAGGAAGCACAGACGCAAGAAAGAGCATTTTA
TTCAAGTCAAAGAAAGAACATAGTAGACGGACACACATCAAGAATTTTTG
CGTGTGCGTTCAATCCTAAATCTCATCACGAGTTGATATCGGGCGGCTGG
GACAACACTGTTATGTGCTGGGATGATAGACAACCTTATGCGACTAGATA
TTGACCTGCTCTTGGCAAGACAAAGAAAGTATTCAACTTTGGGATTATGG
GTCTTGTAAACTAATCGAAACAATAGTTCCTGACAATTACCAGTCAAAGC
TGTATTGTGGCAAATTTGTCCCGAGAACCAATCTAATTGTGTGCGGAGGG
TCTGACTCGAATATGATGAGAGTTGTAGATATTAATCTGAAGATAACAGA
ATGTTCAATTCGAAATAATCCTGGAGGGATATATGCATTCGACTACGGCA
CAATTAGAAGGAAACCAAGAAAAGTGCCTGAAACATACAAAAGGATAAGC
GAAATTGAAAATACTCCAAGAGTCGCCTTTGTTACTGGCAAAAGGCTGCA
AACAGTTGATTTCGGATAATATTAAAAGTCTTAAAACTGTAAAAATCTAT
TTATATAATATTTATAGCGTCAGATGTGTCTATTTTACTTTAATTTATAA
TAAATCAATTTAATATGTATGTCACATTTTTATTCATCATTCATAAA
back to top

protein sequence of HiSeq10015

>HiSeq10015_p ID=HiSeq10015_p|Name=HiSeq10015|organism=Ostrinia scapulalis|type=polypeptide|length=262bp
MEPRRKIQAGPMAPSSMKSARKSFAVTNTYIKSNASAPQKEIITVHTSTP
HVEKRSFHAEQNQVYQGDVNVLSIIDTNKDIMCCKYTEDVNDIAAGFTDG
TIRLFDCNTGNCTHTLVDDECRAYPGPVTAIKHRPVSKAHPITNMLLSSY
VNGCIKCWKYKYDQCLYTIREKRQTLGLCYHPHYTKFITYGDDAKLNMYD
EEAQTQERAFYSSQRKNIVDGHTSRIFACAFNPKSHHELISGGWDNTVMC
WDDRQPYATRXX
back to top