HiSeq10016 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10016
Unique NameHiSeq10016
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length772
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10016HiSeq10016_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10016 ID=HiSeq10016|Name=HiSeq10016|organism=Ostrinia scapulalis|type=mRNA|length=772bp
GCGGTTTCTGACAATGTCCTTTTTCACACATGGTTTTAAAACCGATACTC
TTACGGGATAAGGTGTATGTACAGAAACTCAAAACTTAAAAGTTGTACAT
CAGTTCTATTTTGAATTTATTCTCTCTTTAACATTTCGCTACGCACAAAC
AGCCGTTTAATACAATTTACGTGATAGACAAATACACTGTGATTTCATTT
GTAAATAGTTATAAAACTCTAGAAAGATAAAATATCGAGTTTGGCAAGAA
TTCATAATAAATAAAAAACATAAATACTTCTACATAGTATTATACACAGG
ATTTGAACATCTATTACTCGACCGATTCAAGTTGAGCCTCGTCAACGGAT
GGGTCTTTCCGTGTTGCAATTGTTTTTTGTTTTGAGCTTTCGACATCACA
GTTGAGACCACCACATCGGAGTAGTCGAGCGGCGCCAGCGACACCACGGT
GGGCGCCGGCGGCGGCCGCTCCCCGCCCGCGCCCCGCACCGCGCCGCAGA
ACGAGTTGCGCACGCGCGCGCGCGTCTCCGGCCGCGACCGCCGCGCGCCG
CCCGTCGGCTCGTACTGGTCCACCAGCAGCCGCACCGACAGGTCGCCCGC
CGCCTCGCGCGGGGCCTTGCCGCGCCGCGCCGCCTCGGCCTCCGAGCGCG
CCTCGAACTCCTTCTTGAGGTTGCTCACCAGGCCGGCGGCGGCGGGCGCG
CCGCGCCGCCTCGGCCTCCGAGCGCGCCTCGAACTCCTTCTTGAGGTTGC
TCACCAGGCCGGCGGCGGCGGG
back to top

protein sequence of HiSeq10016

>HiSeq10016_p ID=HiSeq10016_p|Name=HiSeq10016|organism=Ostrinia scapulalis|type=polypeptide|length=187bp
RRRRPGEQPQEGVRGALGGRGGAARPPXAGLVSNLKKEFEARSEAEAARR
GKAPREAAGDLSVRLLVDQYEPTGGARRSRPETRARVRNSFCGAVRGAGG
ERPPPAPTVVSLAPLDYSDVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNR
SSNRCSNPVYXYYVEVFMFFIYYEFLPNSIFYLSRVL
back to top