HiSeq10017 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10017
Unique NameHiSeq10017
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length420
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10017HiSeq10017_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10017 ID=HiSeq10017|Name=HiSeq10017|organism=Ostrinia scapulalis|type=mRNA|length=420bp
ACTATATTTACACAGAACTTACACCCAACACTTTTTTTTTTTGGTAAAAA
TGCATCATTTTAACACAAATGCCTCCTCAACTATTTTTATTTTAAAACAA
ATAAATTAAATTAATATTTATGTAGCTCAACTTTTGGCCTTAGCCATCTC
TTCTTGCTTGTGTTTAGAAATGCAGCTTCTGAACTCATTGACCTCTGTCT
GGCACTTCCTCCAGTCCTTGGTGGTAGCTATGCACTCCTGAACTTTATAA
TGCAGCTCTATACAGCCAGTCTTCTTCAGCATATTTTCGACCGGGTCGTC
ATCATCGTCGGCTGGCCTTTCACGAGGTTTTACGGTCATTTTGAATCGAC
AAAGAAATTTTTATTTGTTGACTTTCACAAGTTCACAACATAACCTCCAT
CGGGTCGTCATCATCGTCGG
back to top

protein sequence of HiSeq10017

>HiSeq10017_p ID=HiSeq10017_p|Name=HiSeq10017|organism=Ostrinia scapulalis|type=polypeptide|length=70bp
MTVKPRERPADDDDDPVENMLKKTGCIELHYKVQECIATTKDWRKCQTEV
NEFRSCISKHKQEEMAKAKS
back to top