HiSeq10018 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10018
Unique NameHiSeq10018
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length754
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10018HiSeq10018_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10018 ID=HiSeq10018|Name=HiSeq10018|organism=Ostrinia scapulalis|type=mRNA|length=754bp
GACATGCTTTCTCGTATGATGTGTATGCTCGAAGCGCGTCGAGAGATGGC
GGGAGTGTAGCCGCGCTGCCTCCCTGCATCGCCGCTAGGGCGGCGTACGA
CTCACGATCACATGGTATCACTTCACTGTATTTTCTTTTTCTATGAACTA
GCGCCTTCCACATCTTGAATTTCGTCTTTTTTGGCCTTTGGAGACTCATT
CACATTGTTTTACACACCTTTCATAGAAACTTTTGTCTATCTTTGAAATT
ATTTCTTGAAAATTACGCAGTTGATTTTCGTTTTGGAATTAGTTCTTTAT
GAGCACAAATATTTAATAATTTTATTATTATTATTAATATCTTGTAGCTT
TAGTAACGAGAACAAAACAATAATAATACTAAGGTAATTATCATCCATTA
CACAGAAGTAGTGCATGAAGATAACAAGCCACATGTTATATTTGTGGATT
GTATTATTTTCTTTATATTGCGTGTTATTATCTCCAGTGATATCACCACC
GGAAAATAAACAACACAATCACAATGCACCAATAAAAACCTTACGAATGC
AAACAATTCCAAAACAGCTGATCAAAACACAATAAAACTGGCACAGCACA
AAGTTTACACTTCACATAAACTTTTTTTAAAAAGTATCGTGAGCGTTCGA
TTCTGATTGAATCGCCGTTCGATTTTCAAAAGTTTTGAAAATCTTGGCGC
GTGTAGCGGATGTGTCGCGACTCGCGGTTCGGAAGCGGCGCGGTACACTG
CGGA
back to top

protein sequence of HiSeq10018

>HiSeq10018_p ID=HiSeq10018_p|Name=HiSeq10018|organism=Ostrinia scapulalis|type=polypeptide|length=54bp
MWKALVHRKRKYSEVIPCDRESYAALAAMQGGSAATLPPSLDALRAYTSY
EKAC
back to top