HiSeq10047 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10047
Unique NameHiSeq10047
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1733
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10047HiSeq10047_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10047 ID=HiSeq10047|Name=HiSeq10047|organism=Ostrinia scapulalis|type=mRNA|length=1733bp
ATGTAGTGTTACTAATTTATTAATTTAGAAAAAGATTTATTGTGTGGATG
TGATCATGAAAGGAATCCTGGTCCAATTGGCGTCAGTACTCATTTTGGGT
ATCGGAGCCTTCATAGGAGCGTATTCGTTGACATGGGTGTCTTACACCGC
ACCTTTGCTGGAGAGCGAGGCTTCTCCCCTCGGGGTGGTGATGACGAAGA
ACCAGACAAATGTCATGACGTCTGTGGTGACCCTGGGATCCATGGTGGCT
GCTCTCACCACTGGACAGCTGCCTGAGCTGGTGGGGAGAAAGAAGTCTGA
GCTGATCTGTGGACTATTATGTGTCCTCTCCTGGGCCTTGATCGCGTCAG
CCCACTCCGTCACTCAAATAATCATAGCTCGATTCATACTGGGCTACGGA
GTCGGCATCCACTTGGTAGTGGTCTTTACCTACATCAATGAGATCTGCCA
GGCCTTCATCAGGGGGACTATGGCCTCGATACCGCTCTTTACATTCTCCA
TTGGGGCTCTGGTGTCTTACATCACCGGATGGGTGTGCAGCTATGACGTC
ATCATCTATCTGAATCTGTCAGTGTGTGTGCTGTTTGTTTTGTTACTGAC
TCTTATGAAGGAGAGCCCAGTGTATTTGATCACGAAGAATGAAACTAAGG
AAGCTCTGACGTCACTAAAGTTTTATCGTGGCACATCTAAAACTACGACG
GCAGTTTTGGAGGAATTCGAGTATTTGAAGACTCAACGACAGGGTTATAC
AAAAGTAAACAAGGATGACAATATTATCCTAGAACACATTGGCTGTGAGA
AAGAGAAAGAAGGCAGCGCCGATGATATTTCTCCTTGGAAGATACTGAGG
ACATCGAAGCCTACCCAGCGAGCGATCATCACGCTGACTGCCCACGTCAT
CATCACAGCATTTATGGGAGCTATGGCGGTGCAAGCGTATGCCGTCCACT
TCTTCCTGGCAGCAGCACCAGATCTATCCCCGCATTTATGTTCAGTCATC
TTGGCTGTGGCGATCGTGATCGGGAACATTCTGGCAGTACTGTGCACGGA
TTTGGTTGGGAGACGGTTGTTGCTAATATCTACTTGCGCCATCTGTACTA
TCTGCCTCGGCGTTCTGGTCGGCCTCCTGCGCTGGTCGGGCAGTCCAGCA
TGGGCAGTTCCATTGGTGATGCTGCTGTATTCCTGCGCCTTCCAGGCAGG
AGTGAACAACGTGCCGTTGGTGCAGCTGTCAGAATCTTTCTCACCAAAGG
TGAAGAGCTTAGCCTCCTCCATCGTCATGAGCAGCACTTGCTTCAGCAAC
TTCGCTTTGCTCTCAATATTCAGTCTTCTTGTGGACCACCTGGGTCTTGA
CGGAACATTCCTGATGTTCTGTGTCATATCTGCGGCAGCTACTGTGCTGA
CCTTCTTGACGGCGAAGGAAACCAAAGGGATTAGGCTAGAAGAGATACAG
GGCATGTACGAGAGGGGATTTTTATATTACAAATAGTTGTAGTACCTATT
TAATTTGTATTATATCAGGAATATAGATCAGGGTCTTATTTAGAAAAGTG
TGAATTTCAATCTGTCACAGAAGGGTCCAAATAAATGTGCAGAGGAGAGT
CAGAATCAATAAACACGTAATAACATTGTTAAAATTGTACTGACTTACGC
CCTTATTCACAAACGATGCTTGCTTGATTGAAGTACCAAATCGAACACAC
AGCGTTCATTACAGCTCTGTGATTGGTTCGTGT
back to top

protein sequence of HiSeq10047

>HiSeq10047_p ID=HiSeq10047_p|Name=HiSeq10047|organism=Ostrinia scapulalis|type=polypeptide|length=476bp
MKGILVQLASVLILGIGAFIGAYSLTWVSYTAPLLESEASPLGVVMTKNQ
TNVMTSVVTLGSMVAALTTGQLPELVGRKKSELICGLLCVLSWALIASAH
SVTQIIIARFILGYGVGIHLVVVFTYINEICQAFIRGTMASIPLFTFSIG
ALVSYITGWVCSYDVIIYLNLSVCVLFVLLLTLMKESPVYLITKNETKEA
LTSLKFYRGTSKTTTAVLEEFEYLKTQRQGYTKVNKDDNIILEHIGCEKE
KEGSADDISPWKILRTSKPTQRAIITLTAHVIITAFMGAMAVQAYAVHFF
LAAAPDLSPHLCSVILAVAIVIGNILAVLCTDLVGRRLLLISTCAICTIC
LGVLVGLLRWSGSPAWAVPLVMLLYSCAFQAGVNNVPLVQLSESFSPKVK
SLASSIVMSSTCFSNFALLSIFSLLVDHLGLDGTFLMFCVISAAATVLTF
LTAKETKGIRLEEIQGMYERGFLYYK
back to top