HiSeq10051 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10051
Unique NameHiSeq10051
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length730
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10051HiSeq10051_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10051 ID=HiSeq10051|Name=HiSeq10051|organism=Ostrinia scapulalis|type=mRNA|length=730bp
TTATATTCAAATACAATTTAATAACATAAAAAAGATCAAACACACTTTTA
GATTTAATTGACCACGAACATTAGAAGAAATGACTTTCCAATTACAAACA
ACTGCTTGCGCCTACTACCCATATCCTTCTGACTTAGGTACAGGGTGATA
GGAACATCAAGAAATATCTTGATGATAATCTTGGTGCATAATAATGCACC
AGTGGAGAGTGCATGGTACCTTGTAATCAATTGTAATATGTAAAATTTCG
CGACAAATTTGTACAGTCTACACTGTACGTACATAGCAATCTTGCTTTTC
TGTGCTCAGTAGTGTCTGGCAAGCCGCATAGTAGAACTGGTGGTGAGTTT
TGGCGTCGTGGTCCTCCTCCTTCTCGTAAACACCCTCTTCCTCTCAATAC
AGTGCCTGGCCTCAAAGCAGAGGACGGTAGGCACCTCGCAGATAGCCATG
CAGAGGCACCCAGTGGGACAAGGCGGTTGGTTCATGGGACAGAATGGCGG
AGGAGGGGTTGACTCGCATGGAAGACTGCAAAAGCTCCTATTGCAGTGAT
CGAAATAATCATGTATTATTTTGGGAAAAGGGTCCCATTCTTCGGTTTCG
TTTTGTGCATTACTTAATCCAAAAAATAATAAAGCAAATGACAAAAATTT
CACAATCATTTTCACTAATATACCTATTTAATAAGCTATATAAAAATAAA
TTAAAAAAGTGTAAAAATGTTTTCAAAATG
back to top

protein sequence of HiSeq10051

>HiSeq10051_p ID=HiSeq10051_p|Name=HiSeq10051|organism=Ostrinia scapulalis|type=polypeptide|length=59bp
MNQPPCPTGCLCMAICEVPTVLCFEARHCIERKRVFTRRRRTTTPKLTTS
STMRLARHY
back to top