HiSeq10053 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10053
Unique NameHiSeq10053
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length687
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10053HiSeq10053_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10053 ID=HiSeq10053|Name=HiSeq10053|organism=Ostrinia scapulalis|type=mRNA|length=687bp
AAAATGTATTCAAAAACAATAACATAAAATAGATTAAACACACTTTTAGA
TTTAATTGACCACGAACAATATAAGAAACGACTCTATAATTACAAACAAC
TGCTAGCGCTTACTATACCCATATCCTTCGGACTTAGGTACAGGATATTA
TGCACTAGTGGAGAGTGCAAACAGTGGGTACCTTCTAATCAATTGTAATA
TGTAAAATTTTGCGACAAACATGTACAGTCTGCACGTACATAGCAATCTT
GCTTTTCTGTGCTCAGTAGTGTCTGGCAAGCCGCATAGTAGAACTGGTGG
TGAGTTTTGGCGTCGTGGTCCTCCTCCTTCTCGTAAACACCCTCTTCCTC
TCGATGCAGTGCCTGGCCTCAAAGCAGAGGACGGTAGGCACCTCGCAGAT
AGCCATGCAGAGGCACCCAGTGGGACAAGGCGGTTGGTTCATGGGACAGA
ATGGCGGAGGAGGGGTTGACTCGCATGGAAGACTGCAAAAGCTCCTATTG
CAGTGATCGAAATAATCATGTATTATTTTGGGAAAAGGGTCCCATTCTTC
GGTTTCGTTTTGTGCATTACTTAATCCAAAAAATAATAAAGCAAATGACA
AAAATTTCACAATCATTTTCACTAATATACCTATTTAATAAGCTATATAA
AAATAAATTAAAAAAGTGTAAAAATGTTTTCAAAATG
back to top

protein sequence of HiSeq10053

>HiSeq10053_p ID=HiSeq10053_p|Name=HiSeq10053|organism=Ostrinia scapulalis|type=polypeptide|length=50bp
MQCLASKQRTVGTSQIAMQRHPVGQGGWFMGQNGGGGVDSHGRLQKLLLQ
back to top