HiSeq10059 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10059
Unique NameHiSeq10059
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length411
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10059HiSeq10059_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10059 ID=HiSeq10059|Name=HiSeq10059|organism=Ostrinia scapulalis|type=mRNA|length=411bp
GGTATATTATCAGGGAATCAGCAAAACTTTCTCCAATAATATATGGTAAG
ATTAAACCATAAAAGGCTTCAGAACTATGTAGCCTTAAATCTATGGGTCG
AAACACCCATCCAACATATATCCCGCACTCGGGACAAACGCAGAGCCTCG
ACTCGTATCCAGGAAACCAAGAGCTTTCTTCCCACTCACCAACACCTTTA
CAAGTTGATTCCGTTGTAGTTATTAAAGGATATTCAAAAAATAACCCGCT
TAAGAATTTCTGAACCAAGATATCCTGATTGAAAAACACTTTGTCATAAA
AGCTATGACGAGACATGGGGCTGGTTTTTGAGATGATGTGGTTTGTTTTA
CATATTTCATATCCGCAATTTCGACATAGAACTAACTCGTGAAACGGATT
TGAGTACTGCA
back to top

protein sequence of HiSeq10059

>HiSeq10059_p ID=HiSeq10059_p|Name=HiSeq10059|organism=Ostrinia scapulalis|type=polypeptide|length=105bp
MSRHSFYDKVFFNQDILVQKFLSGLFFEYPLITTTESTCKGVGEWEESSW
FPGYESRLCVCPECGIYVGWVFRPIDLRLHSSEAFYGLILPYIIGESFAD
SLIIY
back to top