HiSeq10063 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10063
Unique NameHiSeq10063
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1178
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10063HiSeq10063_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10063 ID=HiSeq10063|Name=HiSeq10063|organism=Ostrinia scapulalis|type=mRNA|length=1178bp
GTGAAATTATGACTTTCGATCGTAAGTCCACCTTTTTTAAAAATCAAACT
ACTGTGGGACGGACGGCATCCATTTCAAGTTCTAACTTGTTAGTTTGTTA
GCCAGTCCATAGATTTATGAGTCAATGGTCATTGGCTGTATGGAAGAGAT
CCAAAGCCGTAAAACTTGCATTAAAAAAAGTTATTCCATCTGACGTTTAG
TTTAACTGACATCTGTCAAATCTGTCATTAAGTCGTGACGTGACCCAACG
TAACCCGCATTCAGACAAAAACAGACAAAAAGTTAGAAATTGTTTTAAAA
GCACGATTTTCCTTTCATCCTGGTAAATTTAAAAAATAAGACGTGTTAGC
TGACAAAGTTATGTCTGTGTCACTAAAGGAAACTTTCCTCTACTTTGCTT
ACGGGAGTAACTTATTGAAGAAACGAATACGTATCAACAATCCATCGGCC
CACTTTATAGGCATCGGTAAACTGGATAATCATCACTTAGATTTTATCAA
GTATTCTGAAAACTGGCGAGGTTCTTCGGCTACAATAGTTCCGGTAGAAG
GATGTCATGTATGGGGTGCTGTTTGGCAACTGGATATTATTGATATGCCT
GCTTTAGATATACAAGAAGGTGTTGACACAAATTGGTATTTTCCAAAAAC
AGTCGATATTATCACACTTCATGGAGAAACACTGCAATGTAGGACATATC
AGCAAACAGTCAATCCTGTTCCATGTAAAAAAATTGATGAATTGCCAGAA
GAAAGAAGACCATCTTCTACTTACTTAGAGTGTATTCTTACTGGAGCAAC
TGAATGCCAGTTGCCAAATGATTATATTCAAAATTTGAGAAAAATACCTC
ATAATGGAAATGAAGCATCGCCTAAGATGATTGAAAAGTTGAAAAATTAA
AGTTTCTATTTTATTATTATGATATTAAGTATTATTTAGTGAAAATGCAA
ATACCTAATACATAATTATGTATATTTACATTGCCTTACCAATATTTCTA
CAAATATAATAAGTGCTTGTTAATTAGTAGTATTATTTGATACATTGACC
TAAAATTAACCAAGTCAAGATAAGAAAAGGTGTCTGTAGTTAAATCTCTT
TTTATTAGGAAATACATACAGGGTGGCCAAAATAGTGAGGTCTACAAGAA
AAACTTAGATTCCTGACATCAAGGTGTA
back to top

protein sequence of HiSeq10063

>HiSeq10063_p ID=HiSeq10063_p|Name=HiSeq10063|organism=Ostrinia scapulalis|type=polypeptide|length=179bp
MSVSLKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSE
NWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDI
ITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQ
LPNDYIQNLRKIPHNGNEASPKMIEKLKN
back to top