HiSeq10064 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10064
Unique NameHiSeq10064
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1249
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10064HiSeq10064_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10064 ID=HiSeq10064|Name=HiSeq10064|organism=Ostrinia scapulalis|type=mRNA|length=1249bp
GTGAAATTATGACTTTCGATCGTAAGTCCACCTTTTTTAAAAATCAAACT
ACTGTGGGACGGACGGCATCCATTTCAAGTTCTAACTTGTTAGTTTGTTA
GCCAGTCCATAGATTTATGAGTCAATGGTCATTGGCTGTATGGAAGAGAT
CCAAAGCCGTAAAACTTGCATTAAAAAAAGTTATTCCATCTGACGTTTAG
TTTAACTGACATCTGTCAAATCTGTCATTAAGTCGTGACGTGACCCAACG
TAACCCGCATTCAGACAAAAAGTTAGAAATTGTTTTAAAAGCACGATTTT
CCTTTCATCCTGGTAAATTTAAAAAATAAGACGTGTTAGCTGACAAAGTT
ATGTCTGTGTCACTAAAGGAAACTTTCCTCTACTTTGCTTACGGGAGTAA
CTTATTGAAGAAACGAATACGTATCAACAATCCATCGGCCCACTTTATAG
GCATCGGTAAACTGGATGTTTGTACTTAAATTACTATCACACTAACGTTT
GTACATCTGAAGAAAATAGCTAACATTACAACAATTATATTTTTGTAGAA
TCATCACTTAGATTTTATCAAGTATTCTGAAAACTGGCGAGGTTCTTCGG
CTACAATAGTTCCGGTAGAAGGATGTCATGTATGGGGTGCTGTTTGGCAA
CTGGATATTATTGATATGCCTGCTTTAGATATACAAGAAGGTGTTGACAC
AAATTGGTATTTTCCAAAAACAGTCGATATTATCACACTTCATGGAGAAA
CACTGCAATGTAGGACATATCAGCAAACAGTCAATCCTGTTCCATGTAAA
AAAATTGATGAATTGCCAGAAGAAAGAAGACCATCTTCTACTTACTTAGA
GTGTATTCTTACTGGAGCAACTGAATGCCAGTTGCCAAATGATTATATTC
AAAATTTGAGAAAAATACCTCATAATGGAAATGAAGCATCGCCTAAGATG
ATTGAAAAGTTGAAAAATTAAAGTTTCTATTTTATTATTATGATATTAAG
TATTATTTAGTGAAAATGCAAATACCTAATACATAATTATGTATATTTAC
ATTGCCTTACCAATATTTCTACAAATATAATAAGTGCTTGTTAATTAGTA
GTATTATTTGATACATTGACCTAAAATTAACCAAGTCAAGATAAGAAAAG
GTGTCTGTAGTTAAATCTCTTTTTATTAGGAAATACATACAGGGTGGCCA
AAATAGTGAGGTCTACAAGAAAAACTTAGATTCCTGACATCAAGGTGTA
back to top

protein sequence of HiSeq10064

>HiSeq10064_p ID=HiSeq10064_p|Name=HiSeq10064|organism=Ostrinia scapulalis|type=polypeptide|length=101bp
MPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDEL
PEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKLK
N
back to top