HiSeq10066 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10066
Unique NameHiSeq10066
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length760
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10066HiSeq10066_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10066 ID=HiSeq10066|Name=HiSeq10066|organism=Ostrinia scapulalis|type=mRNA|length=760bp
GCGCGCCCGTCCGGCGGCGGCGGAGGCGCGGCCGGCGCGCGCGCCGCTGA
GGACTGAATCTCGCCTAGTGTAGTGGGTCGATGTGTTACTGATTTATTTA
TGCGAGCCCGGCTCGACTCTTGTGATAAAGGCCGTCCCGCCGGCGCCCGC
GCGCGCGCTCCCGTCGCGTACGATCGTTACGACCGGGAGCGCGGTGACGA
GTGGACACTGTATAAACTTAGGTTTATACGTTTAGCGAGCGAATGTATCT
CGAATGCCGGTCAGCTACTGGATGTAGTTGACGCGAGGCGGAGGGCGGCG
CCCGCGGGACGGCGCCCGTAGCGCGTAAGTAGGTGAAGCGTGTAAGCGAC
TCTGACATCACATGTATGTATAGTGCGTAAGTAGCAGTATATTCTGTTCA
TGTGTATGGTTGTTGTGGTAATTTATTTTGTTACTGACTTGGCGTCAGCG
CCCTGTGATTAAAAGTGCATTATTTTTAGTTTGTGTTTTAATTATTTGAT
CACATCGGTACAGACGATAGCGCATCAGACTTTACATTTAAGTTTTTATT
TTTAGTATTCACGTCTTCCTTCAAAAACAAGCGACAGCATGGGCACCTTA
ACACTAATAAGCTAATATTTTATATCATACGATAGCTAACATGTTGTCTT
TTAGCTAATAGAAGTGGTAGAAGTAGAAAATAGACACAAGCCCCATACAT
TTTAAGATAGTAAGTAAAAAAAAACATTAGTTTACCTACTTTTTTCACTT
CTTTTTCAGT
back to top

protein sequence of HiSeq10066

>HiSeq10066_p ID=HiSeq10066_p|Name=HiSeq10066|organism=Ostrinia scapulalis|type=polypeptide|length=46bp
TEKEVKKVGKLMFFFTYYLKMYGACVYFLLLPLLLAKRQHVSYRMI
back to top