HiSeq10071 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10071
Unique NameHiSeq10071
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1048
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10071HiSeq10071_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10071 ID=HiSeq10071|Name=HiSeq10071|organism=Ostrinia scapulalis|type=mRNA|length=1048bp
ACTCACGAAAAACATTAATCGCTCACATGCTCATACGTTTTTTTATGGTT
TCTAATTGTATAGTTATACGTATTTATACATTTTAGGCGACGAAATATAA
ACTACGTTACCGTCTTCCGGACCCGCCGTGGCACCGGCCTCCTCCATCAG
CACCGAAAACCAATCCAGCAGTCTGTTGGCCATCTTATCCAACGCGCAGC
CTTCCGAGCCCTGGCGGCGCCGCGCCGGCCGCTCGGGCAGCACCTCGTTG
TGCTCCGGATCCTGCTTGCGGCGGCGCCACTCATCTTCATACTCGTCGAA
GTTGCGCCTGGAGGCGCGCTGGCGGCCGCGCTGGCGTCGCAGGCCGCGCG
GCGGCGCGTGCGTGCCGCGGTGGGGCTCGCGGCCGGGCCCTGCGGACAAC
GAGCGTGCGTCAGCGACGTCCGGCAGCCCGCGCTCCGGCGTGACCGGCGT
CCCTCCGAGCGAGCGGTCGCGCTCACCCTTGCGCCAGTCGCGCTCCGGCT
CGCGGCAGGGGCAGAAGCCGCGGCAGGCGAGGCGCACGGGGCGCGCGGCG
CGGCGCACGCAGTTGTGCAGGTCGAGGCGGCACAGCGACGAGTACGTGCG
GTTGTCGGAGCCGCACAGGAACTCGGCGCGCGCGCGCACCGGGCAGCCCA
CGCACCGGTCGGGCGCGTCGGCGTCGGGCTCGGGCGCGTCGGCGCCGGCG
TCGTAGAACACGTCCTCGTCGTCCACGCGCGCCCAGCCGCCGCTCGTCTC
CTCCGACGCGCTCACCGTCTGCGCCACTATCACGTCGCCTTTGCGTAGTA
TCTCCTTCTTATTGGCACAGAATGCCGTGTAAGTATCTTTCAGAAGACAA
ACATCCCGACGCTTACACACCAGTGACTGGCACAACGTATTGTGTGGGTC
GTACATGTAGCGCCGCGGCCGGCGCGCGCGGCCCGCGTCGCCCGCGCGGC
CCGCATCACTCGCGCGGCCCGCGTCACCCGCGCGGCCCGCATCACTCGCG
CGGCCCGCGTCACCCGCGCGGCCCGCATCACTCGCGCGGCCCGCGTCA
back to top

protein sequence of HiSeq10071

>HiSeq10071_p ID=HiSeq10071_p|Name=HiSeq10071|organism=Ostrinia scapulalis|type=polypeptide|length=144bp
MYDPHNTLCQSLVCKRRDVCLLKDTYTAFCANKKEILRKGDVIVAQTVSA
SEETSGGWARVDDEDVFYDAGADAPEPDADAPDRCVGCPVRARAEFLCGS
DNRTYSSLCRLDLHNCVRRAARPVRLACRGFCPCREPERDWRKX
back to top