HiSeq10072 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10072
Unique NameHiSeq10072
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1070
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10072HiSeq10072_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10072 ID=HiSeq10072|Name=HiSeq10072|organism=Ostrinia scapulalis|type=mRNA|length=1070bp
GCGCCGCGCGCCGCAGGCAGCCGCACCACGCCGCGCGCGACACCCCGCCT
GCGTCCGCGCCGTCCGCGCCGCCGCACGACGACAGGAACGGCCGCAGGCA
GCGCTCGCGCTCGTCGTGCCTCAGAGAATAGAGATTTGTCGCCGAAAGAA
CTCCGTCGCCGTCCGTGTCTAGGTGCGCGAACATCCAACGCACTTCGGGT
TTGCAGTCGCTCGGGAACCCGTCTTCCGGACCCGCCGTGGCACCGGCCTC
CTCCATCAGCACCGAAAACCAATCCAGCAGTCTGTTGGCCATCTTATCCA
ACGCGCAGCCTTCCGAGCCCTGGCGGCGCCGCGCCGGCCGCTCGGGCAGC
ACCTCGTTGTGCTCCGGATCCTGCTTGCGGCGGCGCCACTCATCTTCATA
CTCGTCGAAGTTGCGCCTGGAGGCGCGCTGGCGGCCGCGCTGGCGTCGCA
GGCCGCGCGGCGGCGCGTGCGTGCCGCGGTGGGGCTCGCGGCCGGGCCCC
TTGCGCCAGTCGCGCTCCGGCTCGCGGCAGGGGCAGAAGCCGCGGCAGGC
GAGGCGCACGGGGCGCGCGGCGCGGCGCACGCAGTTGTGCAGGTCGAGGC
GGCACAGCGACGAGTACGTGCGGTTGTCGGAGCCGCACAGGAACTCGGCG
CGCGCGCGCACCGGGCAGCCCACGCACCGGTCGGGCGCGTCGGCGTCGGG
CTCGGGCGCGTCGGCGCCGGCGTCGTAGAACACGTCCTCGTCGTCCACGC
GCGCCCAGCCGCCGCTCGTCTCCTCCGACGCGCTCACCGTCTGCGCCACT
ATCACGTCGCCTTTGCGTAGTATCTCCTTCTTATTGGCACAGAATGCCGT
GTAAGTATCTTTCAGAAGACAAACATCCCGACGCTTACACACCAGTGACT
GGCACAACGTATTGTGTGGGTCGTACATGTAGCGCCGCGGCCGGCGCGCG
CGGCCCGCGTCGCCCGCGCGGCCCGCATCACTCGCGCGGCCCGCGTCACC
CGCGCGGCCCGCATCACTCGCGCGGCCCGCGTCACCCGCGCGGCCCGCAT
CACTCGCGCGGCCCGCGTCA
back to top

protein sequence of HiSeq10072

>HiSeq10072_p ID=HiSeq10072_p|Name=HiSeq10072|organism=Ostrinia scapulalis|type=polypeptide|length=309bp
MYDPHNTLCQSLVCKRRDVCLLKDTYTAFCANKKEILRKGDVIVAQTVSA
SEETSGGWARVDDEDVFYDAGADAPEPDADAPDRCVGCPVRARAEFLCGS
DNRTYSSLCRLDLHNCVRRAARPVRLACRGFCPCREPERDWRKGPGREPH
RGTHAPPRGLRRQRGRQRASRRNFDEYEDEWRRRKQDPEHNEVLPERPAR
RRQGSEGCALDKMANRLLDWFSVLMEEAGATAGPEDGFPSDCKPEVRWMF
AHLDTDGDGVLSATNLYSLRHDERERCLRPFLSSCGGADGADAGGVSRAA
WCGCLRRAA
back to top