HiSeq10073 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10073
Unique NameHiSeq10073
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1163
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10073HiSeq10073_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10073 ID=HiSeq10073|Name=HiSeq10073|organism=Ostrinia scapulalis|type=mRNA|length=1163bp
AGGGCCGCGCCGCGCGCCGCAGGCACCCGCACCAAGCCGAGCGCGACACC
CCGCCTGCGTCCGCGCCGTCCGCGCCGCCGCACGACGACAGGAACGGCCG
CAGGCAGCGCTCGCGCTCGTCGTGCCTCAGAGAATAGAGATTTGTCGCCG
AAAGAACTCCGTCGCCGTCCGTGTCTAGGTGCGCGAACATCCAACGCACT
TCGGGTTTGCAGTCGCTCGGGAACCCGTCTTCCGGACCCGCCGTGGCACC
GGCCTCCTCCATCAGCACCGAAAACCAATCCAGCAGTCTGTTGGCCATCT
TATCCAACGCGCAGCCTTCCGAGCCCTGGCGGCGCCGCGCCGGCCGCTCG
GGCAGCACCTCGTTGTGCTCCGGATCCTGCTTGCGGCGGCGCCACTCATC
TTCATACTCGTCGAAGTTGCGCCTGGAGGCGCGCTGGCGGCCGCGCTGGC
GTCGCAGGCCGCGCGGCGGCGCGTGCGTGCCGCGGTGGGGCTCGCGGCCG
GGCCCTGCGGACAACGAGCGTGCGTCAGCGACGTCCGGCAGCCCGCGCTC
CGGCGTGACCGGCGTCCCTCCGAGCGAGCGGTCGCGCTCACCCTTGCGCC
AGTCGCGCTCCGGCTCGCGGCAGGGGCAGAAGCCGCGGCAGGCGAGGCGC
ACGGGGCGCGCGGCGCGGCGCACGCAGTTGTGCAGGTCGAGGCGGCACAG
CGACGAGTACGTGCGGTTGTCGGAGCCGCACAGGAACTCGGCGCGCGCGC
GCACCGGGCAGCCCACGCACCGGTCGGGCGCGTCGGCGTCGGGCTCGGGC
GCGTCGGCGCCGGCGTCGTAGAACACGTCCTCGTCGTCCACGCGCGCCCA
GCCGCCGCTCGTCTCCTCCGACGCGCTCACCGTCTGCGCCACTATCACGT
CGCCTTTGCGTAGTATCTCCTTCTTATTGGCACAGAATGCCGTGTAAGTA
TCTTTCAGAAGACAAACATCCCGACGCTTACACACCAGTGACTGGCACAA
CGTATTGTGTGGGTCGTACATGTAGCGCCGCGGCCGGCGCGCGCGGCCCG
CGTCGCCCGCGCGGCCCGCATCACTCGCGCGGCCCGCGTCACCCGCGCGG
CCCGCATCACTCGCGCGGCCCGCGTCACCCGCGCGGCCCGCATCACTCGC
GCGGCCCGCGTCA
back to top

protein sequence of HiSeq10073

>HiSeq10073_p ID=HiSeq10073_p|Name=HiSeq10073|organism=Ostrinia scapulalis|type=polypeptide|length=340bp
MYDPHNTLCQSLVCKRRDVCLLKDTYTAFCANKKEILRKGDVIVAQTVSA
SEETSGGWARVDDEDVFYDAGADAPEPDADAPDRCVGCPVRARAEFLCGS
DNRTYSSLCRLDLHNCVRRAARPVRLACRGFCPCREPERDWRKGERDRSL
GGTPVTPERGLPDVADARSLSAGPGREPHRGTHAPPRGLRRQRGRQRASR
RNFDEYEDEWRRRKQDPEHNEVLPERPARRRQGSEGCALDKMANRLLDWF
SVLMEEAGATAGPEDGFPSDCKPEVRWMFAHLDTDGDGVLSATNLYSLRH
DERERCLRPFLSSCGGADGADAGGVSRSAWCGCLRRAARP
back to top