HiSeq10074 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10074
Unique NameHiSeq10074
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length794
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10074HiSeq10074_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10074 ID=HiSeq10074|Name=HiSeq10074|organism=Ostrinia scapulalis|type=mRNA|length=794bp
GTACGGTCGTTGATGTTCGCGTCGTCAGTTCGCGTCGTTTCGTAAGCCGT
TGCTGGTGGCATCAGTTTATAGTGACAGTAAAATTAGGGCGTTGTGTGTT
CAGTGATATTTATCTAGTTTAAATAACACAAGAAGATGTCTTTCAACACC
GACATATCGACTAAATTGGAAAATAGCAGGAACAGTCTGCGCAAAATCGC
CCGGCACGATGATACAGAGTTCTCAAAACAGAGCATCCTCAATGACATGG
AGAAGTTTGTGAAAATGGTGACCGCCATGGACGAGACAGTGCTGGTTCCC
AGCCGTCTGATGAACTTGCCGCAGGAGGGTGACGATGACCCATTCAGCAT
GTTTTCCATGCTGAACGACTTGAAGACTGAGCTGCTGTGGTCGGGTGATA
ACGAGGACCACGTGGAGCGAGGCAGGCGGGTGTCTGATATCAGTGATACC
GAGAGTGACGCGTCCAGTGCCGCTGGGGACTCCGGGATCGAGGGCGAGGA
TGAGAGGGAGTCTGCTGCGAGGGCCGCGGCGGCCTGCCGGCGACACCTGC
GCGGGCTCCGGCGGTCGCTGCGCACTCTGACCGCCGCCGCCGCGCACCTC
ACGAGGTCGTATCAGGAAGAGGTCGGCGCGCCAGTCTAGAACTTCTGTTC
GTATATCCTGTGATCGAAGCCTGTCCCGCACGCGGTGTACATATAGACTA
AGCGGCCCGAGCTGTACATATAGGTTAAAAGGGCTGAACGTGTATGGGAA
TCTCAGTAAGTTAACGAGGTTATTAATTATTTAATAAACTTAAT
back to top

protein sequence of HiSeq10074

>HiSeq10074_p ID=HiSeq10074_p|Name=HiSeq10074|organism=Ostrinia scapulalis|type=polypeptide|length=167bp
MSFNTDISTKLENSRNSLRKIARHDDTEFSKQSILNDMEKFVKMVTAMDE
TVLVPSRLMNLPQEGDDDPFSMFSMLNDLKTELLWSGDNEDHVERGRRVS
DISDTESDASSAAGDSGIEGEDERESAARAAAACRRHLRGLRRSLRTLTA
AAAHLTRSYQEEVGAPV
back to top