HiSeq10079 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10079
Unique NameHiSeq10079
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length650
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10079HiSeq10079_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10079 ID=HiSeq10079|Name=HiSeq10079|organism=Ostrinia scapulalis|type=mRNA|length=650bp
GCCCTGCCACCACACGGCGGCGTCTCCGGTCAGCAACATGGCGAGGCCGC
GCAGCGCGTGTTCGTCACTCACTGCGGCGCACTCTTTGTACACGACGATG
TTCTCGATGAACGCCTCCAGTACCTCGGCGCTCCGGGTGGCACCGTCGAA
GCGTGCGGTGCACCGTGTGAAGTTGCCGCCTTGCGGCGCGGTCGCGGTCG
CTGCCGCGGGGTCGGTAACTCGGGTCGGAGTCGCCGGCGGCGGCCCGTGT
AGGTCGCCGGCCGGGGTCGGAGTCGGTAAACCTCTGATGACATTGGTGAT
CAGTCTCGCCAACTGGTCCTCTGTGATCCCGATGACGTCGTTGCGGCTGG
TAGTAGTCGGCGTCGTCGCCGAAGCTTCGCGGGCGGGTATGGCGGCGCCG
GGCCCCGCGTTCACAGTCGCGTCGTCGTTTTCGTCATCGCTGGAATAATA
TCTCTCCTCTTCTTGGCTATCTTTGGCCGTGCCTCGGCGTGTCTTCGGTG
GCATTTTCTCACTTCAACACAATTTTCAATCAACACGACTCACTGGGGTC
GCGGTACTTGTGGTTTCTCTCGAACGTTCTCGAAGTTAGAACGCGAGGCC
ACTCGTTGGGCGCAATTGTAATTTGTGGATTTACATTAATAACCATTAAA
back to top

protein sequence of HiSeq10079

>HiSeq10079_p ID=HiSeq10079_p|Name=HiSeq10079|organism=Ostrinia scapulalis|type=polypeptide|length=217bp
LMVINVNPQITIAPNEWPRVLTSRTFERNHKYRDPSEXVLIENCVEXEKM
PPKTRRGTAKDSQEEERYYSSDDENDDATVNAGPGAAIPAREASATTPTT
TSRNDVIGITEDQLARLITNVIRGLPTPTPAGDLHGPPPATPTRVTDPAA
ATATAPQGGNFTRCTARFDGATRSAEVLEAFIENIVVYKECAAVSDEHAL
RGLAMLLTGDAAVWWQG
back to top