HiSeq10080 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10080
Unique NameHiSeq10080
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1433
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10080HiSeq10080_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10080 ID=HiSeq10080|Name=HiSeq10080|organism=Ostrinia scapulalis|type=mRNA|length=1433bp
TATTTACGCATTTCTTGCTTTTCGTTTTTCCTATCTTCGATTTTTTAATT
TATAGTAAAAAAAATGTATGTATCGTACATTTTTTATTCATTGCGATCAT
CATACGAAAGAAGGGATTTCAAAAACAAGACAAACGATGAAATCACAAAA
CATTTATAAAGCTAAAAAGGTATATTTCTAACAGCGATAAAAATAGCTTA
ACTTTTGGAAATCTGTCTTTTAGTTTTGTCATAGATACATTTGTTTCACT
TTTCTTACGACATATTTTACTATCTCCCAGTGTCGCTTCTCCTGAGCGCG
TGGTAATACTGTAGGAACTTGTCGCGGTTCGCCCAAATGTGAGTGCCTCC
CCAGTGGCACCACGCTATTCCAAACAGAGCTCCACCAAGATGAGCTGCAT
GATCAAAGAACTTCCATCCTAGGAGTACTCCAGCTAAGTCCACGCTCATT
ATAGCTTTTATGGCTGTGCCAGCAGCAAATGTGTACATAGGCAGGAATAT
TATGCTAAGCCTGGTGTCGGGGTACTGTACGCACACGTATGACAGCACCG
ACATGATTGCTCCCGACGCGCCGAGACTAAGGCCAGGCTGATTGAAGACC
ACCTTGTATAGGAAGCTGGAGAAACTGCTGATGACACCAGCACTCAAGTA
CATGGCCACAAACTGCTCCTTGCCCAATGACGCTATTGCAGCTGGCATAA
AGCTGTAGAGGACATACATATTTGCAGCCAAGTGTAGGGCTGAATAGTGA
CTGAATGTAGACAACAGCATTGGTGAACATATTGCACTGCCCGATGGATT
TGAACAGAAGTATTTAACCATGATCGGCTGGAGGGACCTGACCCGCCAGG
CTCCAAACACCAGTACATTCGCAGCTAGGATAGGGTAGAACACCTTCTCG
CTTTCTCTTAGAGAGTTCCACCATTTCTTTATGGGGCCTGGCTCAGATTT
AAAATGTGTCATAAGTTTCTTTTGTTGGGCACTCAGCCAGTTCCCTGGTC
TCTTGAGAATCGTTGAGTGTGCCCGCAAGTTCTCATATTCCCAGATCACA
CAGCCCACAAGACTGGCAGCAGATACCCCAACAGCAAAGAAGAAGGGTCT
TACTAAGCCCTTTGCGTTTAAAGGACCGGACTCAATCCTTAAGTGTTCAA
GTGGATCTGGTTCCAGGGCCGCGCGCCGCACACTGCGCTTGGCTTTTTGG
AACGAATGTCGGAACTGAATGCGGGCATGACCGAAGGAGATGCGGCCTTG
GTTCAGCAACACAGGCTTGCAACTTTTCGTCAACTCCACCGCCGACCAAA
CATTTCTGCAGAACATGATATGAAATTTAATTGCTTGTATTGTGTTTCTT
CTACGTTACATTTTCTGAATTAATTAGGGTGAGGAGAAGTTACAAAATTT
TCATACGAAATTTCAAATTCATGACATACTTTG
back to top

protein sequence of HiSeq10080

>HiSeq10080_p ID=HiSeq10080_p|Name=HiSeq10080|organism=Ostrinia scapulalis|type=polypeptide|length=348bp
MFCRNVWSAVELTKSCKPVLLNQGRISFGHARIQFRHSFQKAKRSVRRAA
LEPDPLEHLRIESGPLNAKGLVRPFFFAVGVSAASLVGCVIWEYENLRAH
STILKRPGNWLSAQQKKLMTHFKSEPGPIKKWWNSLRESEKVFYPILAAN
VLVFGAWRVRSLQPIMVKYFCSNPSGSAICSPMLLSTFSHYSALHLAANM
YVLYSFMPAAIASLGKEQFVAMYLSAGVISSFSSFLYKVVFNQPGLSLGA
SGAIMSVLSYVCVQYPDTRLSIIFLPMYTFAAGTAIKAIMSVDLAGVLLG
WKFFDHAAHLGGALFGIAWCHWGGTHIWANRDKFLQYYHALRRSDTGR
back to top