HiSeq10084 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10084
Unique NameHiSeq10084
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length398
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10084HiSeq10084_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10084 ID=HiSeq10084|Name=HiSeq10084|organism=Ostrinia scapulalis|type=mRNA|length=398bp
GTATGGAAGTTTCCGTACCCTGGCCAAGACTGCCAACATACTGCAACGCT
GACGTTTTAGTCGGCCATTTTGCAGTTTTTACGGCAACTGCTACACGTGT
TCTGGTGCCGAGATGGCAGTTACTAAGAAACCCGTGGCTAAAAAAGCCCA
ATTACACCAGAAGACAGGCAAGAAGGGAGTCAAGGGTGGTAAAATCCGCG
GCAAGGGAATCAAGAGGAAAATCGCTCTAAAGTTTGTGATTGATTGCACA
CACCCGGCTGAGGACAGCATCCTCGATGTAGGCAACTTCGAGAAATACTT
GAAAGAGCACGTCAAAGTCGAAGGAAAAACAAATAACCTCGGCAATCACG
TTGTCATCGCCCGGGACAAGACGAAAGTCGCTATCAATGCAGACATTC
back to top

protein sequence of HiSeq10084

>HiSeq10084_p ID=HiSeq10084_p|Name=HiSeq10084|organism=Ostrinia scapulalis|type=polypeptide|length=95bp
MAVTKKPVAKKAQLHQKTGKKGVKGGKIRGKGIKRKIALKFVIDCTHPAE
DSILDVGNFEKYLKEHVKVEGKTNNLGNHVVIARDKTKVAINADI
back to top