HiSeq10085 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10085
Unique NameHiSeq10085
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length509
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10085HiSeq10085_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10085 ID=HiSeq10085|Name=HiSeq10085|organism=Ostrinia scapulalis|type=mRNA|length=509bp
AAAACTACTGAACGGATTTTGATTAAACTTTACAGTAATGTTAAGTACAT
GAAAATAACAAATAGTCTAATAGTGATCTGTGACAAGCTAAATTACATGT
GGGCGAAGCCATGGGCAAAATAAAATTTAACAATGTGGTGTAAAAATGAG
TAATAGTTAGGAAGTCATTTATGATGAATTGATAAATTAATATTTGTAAT
AATAAAATGTGCAAGTTGCATAGTTACAAGATCAAAAGACTACAAACATA
GGTACTAAAATCTCTAAATCTAAAAAAATATCAAATAAAAGACAAAATAG
TGTAAAACTATTATATTATGAACAGCTTAATCTTCGTTATCTTCATTGTC
GCTGTCAGCGTTGATGTTGAAGTAGCGGAGTTCGTACGAGTCGTGCGCAG
ACGCAACTACTCGCAGCCAGTCACGGAGGTTGTTCTTCTTCAAGTAACGC
TTGGTCAGGTATTTGAGGTACCTCTTTGAGAAGGGAATGTCTGCATTGAT
AGCGACTTT
back to top

protein sequence of HiSeq10085

>HiSeq10085_p ID=HiSeq10085_p|Name=HiSeq10085|organism=Ostrinia scapulalis|type=polypeptide|length=60bp
KVAINADIPFSKRYLKYLTKRYLKKNNLRDWLRVVASAHDSYELRYFNIN
ADSDNEDNED
back to top