HiSeq10087 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10087
Unique NameHiSeq10087
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1992
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10087HiSeq10087_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10087 ID=HiSeq10087|Name=HiSeq10087|organism=Ostrinia scapulalis|type=mRNA|length=1992bp
TGTCAAAAGCCTTTTTTAGGTCAATAAACACGCCCAATGCAATCTTTTTA
TTGTCTATATTGGTTTTTATATCAGTAATTAAATCTAAGGTAGCTGCTAA
TGTGTTTGAATTGGGTCTAAAGCCATATTGAAATTCAGAAAAGAAACCCA
GGGAGGAGAGGTAATCATCCAAACGAGTAAAAATCATTCTTTCAAGAATT
TTTGACATCACTGGTAATACAGAAATTGGGCGATAATTATTTGGATCACT
TGTAGGCCCGGATTTATGTATTGGAGAGACTTTAGCCAATTTAAGAGAAG
CAGGGAAATTTCCCTCGGCTAGAAGTACATTAAAGCAGTTACTGAAATTG
TTAGCCATCAGACCACCAATACATTTTATTTGTTTGGTAGTAACTTCATC
TATACCAGAGCTTGAATGAACATTAAGGTCAGCAATAATCTCGACGACTT
CAGCTTTCGTACATGGCGTAAATTTATCTAGTTTACCATTGTGGTTAAAA
GATGGCATTGAATAAACCGAAGTCAAATGATATTTAGGTAATATTTCATT
TGCTAGCTTTGAGCCTATCGAAGAGAAAAAGTCATTAAAAACCTCACAAA
TCTGCCTCGGATCACTAACTTCACCAGTAGATAGCTTTAACCTTGGAGGA
GCACGATTAATTTTAGTCTTGTTACTAGACAATGTGTTTATTAAAGACCA
TAGTTTCTTTGGATTACCCTTAAGGCCCTCAAATTTGTTAAGGTAGAAAA
TTTCCTTTGTTTTCTTAATAATCTGTCGCACTTTATTACGTAAATTGTAA
TATTCCTCTCGTTTTTGTAAGTTGTCTTGTTCTCTCTTAAGTTCATTCCA
TAGCTTATTTCTTTGGTTTATAGCGTCTATAATTTCTTTATTTATCCAGT
CTTTCTTTGGTAAATTTTCTATTTTTGTTTTGATTTCTTTACTTTTGTTA
ATTGAGGACAGTATGTATTCTTCTAGATCATTATAGTTGCTAAATTCAAG
TTGTTCCTCCTGCATATAATTATATAGTTTTTTGTAATCCGTGGAATTAT
ACTGTGTCTTTTTCAGCTTCGGGGGTTTAGTCTTCTTAATTTCGACATAG
ATTTGTTTGTGATCTGACAAACTAGAATCTACTGTTGCCAAGTGAACATT
AGCATCTGGAAGGTTAGTCAAAACGTGGTCGATTAAGCTGTGTGTAGTGG
CTGTTTCTCTTGTGCAAAACTGTTTTGTAATACGGTTCAGAATTGAGTAT
CCAGATTCCTGAAGTAGTGATTTATAGTGTTTTGTTTTATTATCTGCTCT
ATTCAACAAGTCTATGTTGAAATCACCAAACACTAGGCTTCTTTTGTGCA
CTTGCAATTGTTGTCCAAAGTTATCCAGGAACTCCGAGAAATTTGTGTCG
CCAGGGTTGTAGACCAGTCCGACATCCAGTGCAAATCTTTCGAGATGAAC
CCACAGATAATTATTTCCTCCCACGTATGCAGCATGAAGAGGGGTATGAT
TCAAACTGTCGTGTACATAAGTTGAGACACCTCCACCTCTCTTGTTGTTC
CTTATGTTAAAATAGTGCGTGTAGTTATCCAGTGTAAATATTTTTGCTTC
TTCTTCTGTGGTGATCCATGTTTCGGTGAGAAGTATAACATGGATAGTAG
TAGGTATGGATCGAAGAATGCATTTTAACTCGTCCAATTTGCCAGGCCTT
CGAATACTTCGTACATTGGCATATAGAAAGTTCAGACGGAATCTTGAAGA
GATGAGATTTTCGTATGTGTCCAAGACTTGGTATGTGATATTTTTGTGAG
ATTCATAAGTGACTGTAGAATTCAGTTTTTTTTAGGTTGATTTTTGATGA
TTTTTGGGGTGCCTCTAATGTACTTTATTGTTAGGTTGGTTTCTCCAGCC
TCAAGTCGTTGATTCAGTTCTGTTTTAGTTTCATTGTATATTTTTTTCTG
CATTGGCGTCTGGTCCGTAAATAACTTGAAGGAGGTGTCTAA
back to top

protein sequence of HiSeq10087

>HiSeq10087_p ID=HiSeq10087_p|Name=HiSeq10087|organism=Ostrinia scapulalis|type=polypeptide|length=158bp
MFXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQ
LEFSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKL
WNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKL
WSLINTLX
back to top