HiSeq10111 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10111
Unique NameHiSeq10111
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1139
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10111HiSeq10111_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10111 ID=HiSeq10111|Name=HiSeq10111|organism=Ostrinia scapulalis|type=mRNA|length=1139bp
GATAAACGGCCTGCGGTTTCTATCATCTTGAAGAACTTTTCAAAAGCTAC
AAGTTATGGGGTTTTTTATATTACTTTATTAAATGCTCTCACTATACAAG
GGTACATTTAAATTAATTATTTTAATCTGGTGTATTTAACTAACTGAATT
TTATACAAGTTGAACTTAAATAAATATAGTTATTGAATGAAGACATAAAA
CAAAATCTAAATGTATTATTTACAACTAACATCTAGTTACATTAATAACA
AAGCAACAATTACATGCTAAAAGTTATTTTCAAAAATTTGAAGTAGTCTC
TTTATTTCTGCTATCCTTGCAGCCTGTGCTTGAACAGGGATCATTGCTTG
TGACACCTCTTCACCTTTAGCTAGAATTGTATACATGCTTTTGATGTTAT
TGTCCATCGCATCACATGTCTTGCCAACAGCATCCTTGTATACTTCCATA
TTTTCAGCAGTCAGCGAAGAATTGGAATGCAGTATGCTGGATAAATTTTC
TATTAGATTATCTACTGACTGTGCTATCCTTTGAGCTTCATATTCGAGAT
CATTCAATACTGTTATATCAATTTGTCCTATTTGAGGTGCCAGTATTTGT
CTATAAAGTTTTCCAGAAGGAGTGCTTGATCTGGATGCGCTAGTAGAACT
ACCAAATACTGGAGTTTCGCCTCTCTTAGTTATGGGACTGGAGAGTTTAA
TTTTAAACTCTAAATCATCAGCAACATAGTGAGTCATGTCCCCTTCGTAT
CTCACATGCCCATCCATGTCTAAAGGAAACTTCTCTTGTTTGCGGTTTTC
TGAGGGCAAGTTGTAAGGCCTGGAAGGCCCAGCTGCCTTCTGGTCTTCAG
GACTGAGGCCTTGGTCTGAATGGAATGATATTTCACTGTAGGAAGCCGTC
ATCCGAGCTGATATCTCTTCATCCATGTCCACCACATCCTGTTTGTTGGA
AGGGTCATCGGGCAATTCTTTGTCTTCTGTCGACGGTGAATTTCCTTCAG
CTGGGTTTGACATTATTGAGCAAAATAGTTATTTGAACTTACAATCGTAA
AACTACAATAATATCAACAAACAAAACCCATCCCAAAATCTGACAAAATC
CATCATCAATTTTTTTTGACGGTAGTAGCGATGGGCGTT
back to top

protein sequence of HiSeq10111

>HiSeq10111_p ID=HiSeq10111_p|Name=HiSeq10111|organism=Ostrinia scapulalis|type=polypeptide|length=248bp
MSNPAEGNSPSTEDKELPDDPSNKQDVVDMDEEISARMTASYSEISFHSD
QGLSPEDQKAAGPSRPYNLPSENRKQEKFPLDMDGHVRYEGDMTHYVADD
LEFKIKLSSPITKRGETPVFGSSTSASRSSTPSGKLYRQILAPQIGQIDI
TVLNDLEYEAQRIAQSVDNLIENLSSILHSNSSLTAENMEVYKDAVGKTC
DAMDNNIKSMYTILAKGEEVSQAMIPVQAQAARIAEIKRLLQIFENNF
back to top