HiSeq10113 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10113
Unique NameHiSeq10113
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1626
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10113HiSeq10113_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10113 ID=HiSeq10113|Name=HiSeq10113|organism=Ostrinia scapulalis|type=mRNA|length=1626bp
TTTGATGCCGAGTGTATTATGAAATCCAGCTTTAGGTATATTATAGGAAC
TAAAATCTATTCTTTCTATAATTTACTATTACATAATTTCTTTTTTAAAC
GGATTGGTTTCTCTTTTTAACATTATTTTGGTTACATTTTGGTTTGTTCA
TGAAATCCAGCTTCATATGAACTTAAAATCTGTTAAATTTCTTTAATTTA
ATAAATATTTTGTTCTTTTAACGGATTGGTTTTTTTTTTCTTTTAACATA
CCTATCTTGATTCGGTCATGAAATCCAGCTTCGTGGGAATTAAATCTGTT
CATTATTTATATTTATTCTGTTTTTCTAATATGCCGTGTCATTTGTCTTT
TGTTTGCTCAGTTTTCTACCTCTATATTACTGGCCATGCTCTCATTGCTG
TTTTCGTTCAACGCGATCGGACTTTTACTTTTTTCTTCAGTTTTATCTTT
GGTCTGTGAGTTTTCGCCGTTGCTTTTGTCGTTCTCCGTTCGGTTTTCAC
TCTGACTCGTCCTGTCGAAATCGCATGGCATTGGCATGCCAAAGGCTGGG
TGACCAGGGTAGTACATGTAGGATAGAGGAAGATTTGGGTAGTTAACCCC
CAAATGTGGTCCATACAGAGACTGTAACACCGCTTGGTGGTACGATTCCT
GCAGCAGCGCCTTGTATTCCGGATTCTTAGCGAAATCCACACCATAGACT
CCGGCAAAATGTTTCAAGATCGGCGAACCTTCGAGTAAGTTTGGAGAAGC
GAATAAAGCTGGATTTATTCCTTTGCCTAACATAGGATTCTGGTACTGCT
TCATATCAGGTAGGCTGGGTTGTCCGTTGTTGTTAACCAATACTTTGACG
GCGACTTTCCTAGCATGGTTAGCGGCCGCTGCAGCAGCTGCTAGCATGCC
GTTCTCTTGCATCTGTAGTTGCTTCCTCTTCGTTTTGTATCTTCGGTTTT
GGAACCAAATTTTGACTTGCGTCTCTGTCAATTTGAGGCTGACAGCAAGG
TCTGCTCTTTCTGGGCCTGAGAGGTACCTTTGCTGGCTGAATCGTCGTTC
TAGTTCGTATACTTGTGCGTGTGAGAAGGCTGCGCGGGAGCGTTTCTTTC
GGGCGTTGTTCTGGGTGTAGTCTGGATAAGTCGGGGAGTCGCGGGGAGCG
CGGGGGTCGGGCGGGGGGCTGCCCTTGTCGTAGAGGAAGGGCTTGTAGCC
GAGGTCGGAGCTTGGAGACGAGTGCCGCCGAAGGGGTGAGCCGGTGGTTG
ATGAACGGGAGTCGTAGTCATCTGAAAGTTCTGTGACTGGATAATTGTTT
TTCCTGGACATGTCCAAAGCACCGTCGTCCGCGTAATCTCTGTAGCTGCT
GCAGTCGTCGTAGTACTTCAAACTCTTTTCCAAAACCTCCTTCTTCGGAA
ACTCCTCCTTGGCATAACAGCTTGATGCCTTTGCCAGAAAACTCATCTTC
GCGCCAAAACTCTCTTGACAGTACTTCCCTTCGTTCTCTCTGGTCAAAAT
GTCATTAATCGAAAATGGCGTGCTCAAAGTCTTCTCACAATCTTGCACAG
TCAACGAATCCTTGAAATTTTTCAGTTTCGATTCCATTTTTGAAAATGCA
CATCCACACTTCACCGCGCGGTAGCT
back to top

protein sequence of HiSeq10113

>HiSeq10113_p ID=HiSeq10113_p|Name=HiSeq10113|organism=Ostrinia scapulalis|type=polypeptide|length=362bp
MSFLAKASSCYAKEEFPKKEVLEKSLKYYDDCSSYRDYADDGALDMSRKN
NYPVTELSDDYDSRSSTTGSPLRRHSSPSSDLGYKPFLYDKGSPPPDPRA
PRDSPTYPDYTQNNARKKRSRAAFSHAQVYELERRFSQQRYLSGPERADL
AVSLKLTETQVKIWFQNRRYKTKRKQLQMQENGMLAAAAAAANHARKVAV
KVLVNNNGQPSLPDMKQYQNPMLGKGINPALFASPNLLEGSPILKHFAGV
YGVDFAKNPEYKALLQESYHQAVLQSLYGPHLGVNYPNLPLSYMYYPGHP
AFGMPMPCDFDRTSQSENRTENDKSNGENSQTKDKTEEKSKSPIALNENS
NESMASNIEVEN
back to top