HiSeq10116 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10116
Unique NameHiSeq10116
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length703
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10116HiSeq10116_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10116 ID=HiSeq10116|Name=HiSeq10116|organism=Ostrinia scapulalis|type=mRNA|length=703bp
GGCCTATGATCGCGCCGGCGATGGTGATCTGCAGGCGTTGGTGTGGTTGA
AGCATTACTTACTCGTATTTATTTACATAAGTATACAAAATATACAAAAA
ATACCTTTTACAAAAATAACTAAGGCAAAGTAGGATGCCATCTAAACCTT
GATAAGTAGGGAAATGTTTTACTGCACTACAGGTCATCTCTGGCTGGTAA
CTGTAGTAGCAAGTACTTTAACTATAGTGCACTCGAATAGAAATTGTCTA
TATTCTCTGTATCCCTACTAGCAATACCTAGGTATTTCAGTTAGCAATCA
AAGATAACTCGGAGATGCAAAGGCAATCATTGTTGAAAAGTTTTAGTCTA
GTCCAGCTTCTATTGGCGCAGATCTGTTTATGTGGTCTTTTCAGTATCAG
ACAGACCCCCTTGGAACATGTTGGTCATCTTGTTGATGAACATGGTGATG
ATCTGCGACTCCCCCATGGACCGGTGGAGGGCTTTCATGGCGTCGCCGAA
CTTCTGCTTCTCTTTCGCCGTGCAGTTTGCGCATGATGTGGTGACCATCT
CGAAGATGTCATCTGGATTGTAAATTTTGTCATTTTTAAGATCGAAATCT
TCCAAAAACTGAGATAAGGTATATGACGTATAGGAATAGGTGCAGGTCCC
GATTAGAAATAAGAAAGAGAAATAAGAAGTGAAACAGTTAGTTTTACATG
GTC
back to top

protein sequence of HiSeq10116

>HiSeq10116_p ID=HiSeq10116_p|Name=HiSeq10116|organism=Ostrinia scapulalis|type=polypeptide|length=56bp
MVTTSCANCTAKEKQKFGDAMKALHRSMGESQIITMFINKMTNMFQGGLS
DTEKTT
back to top