HiSeq10117 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10117
Unique NameHiSeq10117
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length899
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10117HiSeq10117_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10117 ID=HiSeq10117|Name=HiSeq10117|organism=Ostrinia scapulalis|type=mRNA|length=899bp
GGCCTATGATCGCGCCGGCGATGGTGATCTGCAGGCGTTGGTGTGGTTGA
AGCATTACTTACTCGTATTTATTTACATAAGTATACAAAATATACAAAAA
ATACCTTTTACAAAAATAACTAAGGCAAAGTAGGATGCCATCTAAACCTT
GATAAGTAGGGAAATGTTTTACTGCACTACAGGTCATCTCTGGCTGGTAA
CTGTAGTAGCAAGTACTTTAACTATAGTGCACTCGAATAGAAATTGTCTA
TATTCTCTGTATCCCTACTAGCAATACCTAGGTATTTCAGTTAGCAATCA
AAGATAACTCGGAGATGCAAAGGCAATCATTGTTGAAAAGTTTTAGTCTA
GTCCAGCTTCTATTGGCGCAGATCTGTTTATGTGGTCTTTTCAGTATCAG
ACAGACCCCCTTGGAACATGTTGGTCATCTTGTTGATGAACATGGTGATG
ATCTGCGACTCCCCCATGGACCGGTGGAGGGCTTTCATGGCGTCGCCGAA
CTTCTGCTTCTCTTTCGCCGTGCAGTTTGCGCATGATGTGGTGACCATCT
CGAAGATGTCATCTTTCATCTCCTTATCTTCTTTATTAGCACACTTAGTT
TCATCCCTCACACATTCAAAAAGCGCTCTCGATCTCGTAGTATTTAGTAA
AAGTGTCTCCATATCAAAATTGTCGTAGTTATGTAACTTTGCAAAACACT
GCACACACAGAAATACCATCAGATGTGATAAAACTAGAACTTTTCTGTGA
GACATCTTACTTGGACTAAGGAAAGGTAGAACTAGTTATCACATACGGTG
TTCTCGTTGGGCCTATTTATGGATAATAAAACAATGCCCTAATTAAACAA
TCGCTATTGTTCCTTTGACGTAAACTTCGGTTACGTGATTGTGAGTAAT
back to top

protein sequence of HiSeq10117

>HiSeq10117_p ID=HiSeq10117_p|Name=HiSeq10117|organism=Ostrinia scapulalis|type=polypeptide|length=125bp
MSHRKVLVLSHLMVFLCVQCFAKLHNYDNFDMETLLLNTTRSRALFECVR
DETKCANKEDKEMKDDIFEMVTTSCANCTAKEKQKFGDAMKALHRSMGES
QIITMFINKMTNMFQGGLSDTEKTT
back to top