HiSeq10118 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10118
Unique NameHiSeq10118
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1358
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10118HiSeq10118_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10118 ID=HiSeq10118|Name=HiSeq10118|organism=Ostrinia scapulalis|type=mRNA|length=1358bp
TAATTATTTATCAATATCTTTATATTAGGCGTTTCCATATTTTATAATTG
ATATCAAATTTTGGCACGTTCGAATTTCGAACTTACCGCCATAACCTCAG
CGTACGCGAATGAAATGTTTTCATTTTTCGTCTCTCGATTTAATTATGGC
GGATGGTGGCTGAACGTCATTCAATGTGATTTTATGTGTGCTCATTTTGA
CAATCGGTAGATTTTTGATGTGAGTGGTTGGTGAAAACGGTAGGAGAGCG
AGGGGGATCATCAGGCGGACGTATGAGAGCAATGGCTGAGAACAGAAGTT
CGGACAACGTCGACATGCCGGACATTGCCGAAGCCGATCCACTGACGGCG
GGGGCCGAGCACCCCGATCACGATGCCGAGCGCGCTGACGGCGGGACGGT
GCTAGCCACCGGCATCAAAACACCGCGGCTCGCCACCGACTCCGGAGTGG
TGACCCTGGTTACGACGGGCACGACGTTCAACGTTATCACCACGGATCAC
CTGCCGCATTTCAAACCAATGTTGTGCGTGGACAACGGCTTCATATCCGG
CGGGCCGGTCCCAGACGACATCAAGGCGGCGCATATTGTGATTCAGAAGC
CAACTTCGCCTGCGGGGTCGGTTCAAGAGGATGGAGCACCCACACAGACC
TCTCCAGCTACCCGCACGGTCAGTGCTAGAACCTGGGCCGAGACTGCTAA
CATGCCAGTACTTCCTGTCCGCTGTAAAAATATATCCGCTGAACTTCACA
AGCAGAGATTTGGCTCCGGTGGCCGGGGGAGGTGCATAAAGTATGGCATG
GTTTGGTACACCCCTAGTGAGTTTGAAGCTCTCTGTGGGAGAGCTTCTAG
CAAAGATTGGAAGAGGTCTATTAGATTTGGAGGGAGAAGTATTCAGACAT
TGATTGATGAGGGCATCCTGACACCACATGCTACAAGTTGCACCTGTGGA
GCTTGCTGTGATGATCAGTCTGCCATGGGTCCCATACGCCTCTTCACACC
ATACAAAAGAAAGCGGAAAACTGCACAGGAAATGGAGGAGAAGAGACCCA
AAGTAAAGCAAGAGAGCAGTATAACTGAGAGTGAGGTTGACAATATACAT
CAGACCAGCAGCAACAGCCATTCGAAGGAAGCCTGGCAGACAATCACCGA
GGGATTAGATGGCAGCACCGAATACCACTTGTTGGAGACACAGGAGCCAG
CAAAGCTGGATCACGCCACTCCGCTGCCCGACATCAACGGCGTGATGAAG
CGGCTGGACGACATCGGACAGACGCTGGTGCGGTTGGCGGGCGAGCTGAA
GCAGTGCGCGGAAGACGTGCGCGTCGTGCACGCGCGCCTCGAGCACGAGC
GCGCCTCC
back to top

protein sequence of HiSeq10118

>HiSeq10118_p ID=HiSeq10118_p|Name=HiSeq10118|organism=Ostrinia scapulalis|type=polypeptide|length=362bp
MRAMAENRSSDNVDMPDIAEADPLTAGAEHPDHDAERADGGTVLATGIKT
PRLATDSGVVTLVTTGTTFNVITTDHLPHFKPMLCVDNGFISGGPVPDDI
KAAHIVIQKPTSPAGSVQEDGAPTQTSPATRTVSARTWAETANMPVLPVR
CKNISAELHKQRFGSGGRGRCIKYGMVWYTPSEFEALCGRASSKDWKRSI
RFGGRSIQTLIDEGILTPHATSCTCGACCDDQSAMGPIRLFTPYKRKRKT
AQEMEEKRPKVKQESSITESEVDNIHQTSSNSHSKEAWQTITEGLDGSTE
YHLLETQEPAKLDHATPLPDINGVMKRLDDIGQTLVRLAGELKQCAEDVR
VVHARLEHERAS
back to top