HiSeq10122 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10122
Unique NameHiSeq10122
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1747
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10122HiSeq10122_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10122 ID=HiSeq10122|Name=HiSeq10122|organism=Ostrinia scapulalis|type=mRNA|length=1747bp
GAATAAATTCCATGCGCGATACAACCTTTCGAAATTATTTTTATTTATTG
TTATGAGTCATTTGTGACTCGTAATATCACAACCAGTGCGCCTTATCAAT
TAGCGTGTACAAATGTTGATTAACCAAGTCTGTATAAATAAACAGTATTT
TATTTGCAAAAACACAGTTGAAACACAAATGCTAATACCTAATACTGTAT
TCAAACAATAGAGTATTTATTTAATAACTTATCGTTTAGATATTTTTACC
CAAATCCCACCTTTTGTCAATAGCACTATGCCTTTTGGGTCATATTCTAA
ATGAGTATCGGTCTTGGGAGATCGTTCAATTTTGAAATTTTTCAAAAACG
CTGCGATGCCCATCAACGATTGCACCTTAGCAAAGCGCATACCTATGCAA
TTTCGGGGCCCTTCACCGAAGGGCAAGTAAGTGCATTGTTTGAGAGTCTT
GATATTTTCTGGCAGAAACCGGTCCGGGTTGAATTTTTCCGGGTTCGGGA
AGTATTCCGGGTCAGCGTGCAATCCATTAGCCGATACCATAATCAAGGTA
CCTTTCGGGATTGTCACGTTAGTACCGGGGATCGTGTAATCCTCAAGCGC
TTTACGGAAAAGAATGCCAGCAACAGAATGCTTCCTCAAGGTCTCGTCCA
ACACCATATCCAAATAAGGCATCTCTTTCAGCGACTCATAAGTTAGTTGC
CCATTATACTTTTCGTAAACTTTACACACTTCTTGATAAATACGATCCTG
TATGTCCGGATTTAACGCTAGCTCATAAAATAGAAAAGACATTGTAGCAG
CAGATGTTTCGAAACCAGCCGAATAAAATACTAAAGCTTGTGCAGCAATA
AGATAGTCATCCATTTCAATTTCTGATATCCCGTCTTCTTTCCTTCTGCT
CACTTTGCCTTGTTCTCTTAACTCTATCATCAAGTCCATAAAATCTTTCC
GTACTGGAGGTGTTCCCTCCCTCTCCTTTATAACATTACGGACTAAACCG
AGAAAAAAATCTAGGATCTCGGTACTCGTTGTAAATAGTTTACGGACGCC
TGGGATCAACATGTCCAAGATAGTTAGGAATCTTACATAAACCGTCGGCT
TAAAAATTTTCTTAGCCATTATACTGAACTGATTTTCTTCATCTGAACAT
GCATCTAAATCTAAACCAAATGCACAGGAGCCTATAACGTCTAATGTGTA
TTTGGATGCTAACGATCTCATTTCATGATCAATATTGTTCTCAACCAGAT
AATCTACATATTTCACAAACTTGTCAACACATTGCTGCATTAAAGGGACC
ATCTCCTTGAGTTTCCTTGATGTAAACACAGGTGTGAGTTTCTGCCTCAA
AATTCTCCACATTTCACCATCTGCTGAAAATAAATTCTGGCTCAGTCGAC
TGCCGCTTGAACTTATCCCTCTATCTTGGAATTTATGAAAGTCTTTAACC
ATCACTTGCTTAATTAAGTCTGGATCTCTAACCAAAAGCATTGGCTGGAA
TCCTCGGTATACTCCAACAAGTTTTTCACCAGCATATTTCAAATGCACTG
TTTTTATATATTGTTGAACTGAGTCTTTCACTAATATCACTGATCCAAAA
TTGCCCACAATAGGAAACGGTGTTGGTCCTTTCACGCCTTTATCCGACCA
GTAACTATACTTTTTTCGTGCGTATAAATAAAATGAACATAATATGACAA
CGAAAAACGCGGCAAAAATATAGACCGCCATATTGATGCAGCGAGCT
back to top

protein sequence of HiSeq10122

>HiSeq10122_p ID=HiSeq10122_p|Name=HiSeq10122|organism=Ostrinia scapulalis|type=polypeptide|length=505bp
ARCINMAVYIFAAFFVVILCSFYLYARKKYSYWSDKGVKGPTPFPIVGNF
GSVILVKDSVQQYIKTVHLKYAGEKLVGVYRGFQPMLLVRDPDLIKQVMV
KDFHKFQDRGISSSGSRLSQNLFSADGEMWRILRQKLTPVFTSRKLKEMV
PLMQQCVDKFVKYVDYLVENNIDHEMRSLASKYTLDVIGSCAFGLDLDAC
SDEENQFSIMAKKIFKPTVYVRFLTILDMLIPGVRKLFTTSTEILDFFLG
LVRNVIKEREGTPPVRKDFMDLMIELREQGKVSRRKEDGISEIEMDDYLI
AAQALVFYSAGFETSAATMSFLFYELALNPDIQDRIYQEVCKVYEKYNGQ
LTYESLKEMPYLDMVLDETLRKHSVAGILFRKALEDYTIPGTNVTIPKGT
LIMVSANGLHADPEYFPNPEKFNPDRFLPENIKTLKQCTYLPFGEGPRNC
IGMRFAKVQSLMGIAAFLKNFKIERSPKTDTHLEYDPKGIVLLTKGGIWV
KISKR
back to top