HiSeq10127 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10127
Unique NameHiSeq10127
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length792
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10127HiSeq10127_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10127 ID=HiSeq10127|Name=HiSeq10127|organism=Ostrinia scapulalis|type=mRNA|length=792bp
CATCATTTTTTTACTTGTTTTTTGACAGCTATTTAACCATTTATTTTTTT
TTCAAATTTCAAACCCTGTTTTGCGCAAAGGTTTTGCGTTTGAGGTGATA
TAGGCTGTATACAAATGGACATGCATGTTAAAAAATCATGACACTGCAAT
TTTATGACATGACATTGTCAATGAAGACGACAGAATCAGATGTTTTGAGA
TTTATACATTCGTAATATTTTATATATTTTGACCATGGAAATAACATATC
AATACACAAAGGTGCGATGCAGCTTCGGGCGGCAGCCGCTGTTCTGCGAG
CAGGGCCCCGAGATGTGCGACTCCGTGGCCGCCAACGAGAAGGAGCAGAA
GCTGTACATCCTGCGCAACCCCGTGCACCAGCCCACGCAGAACACGCCCT
TCTTCTCCGAGAACCACGTCAACACCATCCGGGCGGAGTACTCCACGAGT
GGCGCCAACCACGCCGAGGGCGGCTGGCCCAAGGACGTCAACGTCATCGA
CCCCGAGGCCACGCAGCGCTATCGGCGCAAAGTTGAAAAGGACGACGGCT
ACATACACTGTGTCATGTCACTTTCTGGAGGTATGGAGCACTACGTATTA
CAAAATAATGCAATCGACATGTACGAAACGTACTACGCGGAGATGAGCGC
GCTGCCCGCCGTGGAGCGGAACAGCATGCGCACCGTGAACGTGTACCGCG
ACCCGAGCGCGCCCGGCGCCGGCCGGCCCGTCAGCTCCGTGGCCTGGGAC
CCCGACGGCGGCCACCACTTCGCCGTCAGCTACGTCGACGTC
back to top

protein sequence of HiSeq10127

>HiSeq10127_p ID=HiSeq10127_p|Name=HiSeq10127|organism=Ostrinia scapulalis|type=polypeptide|length=219bp
MTLQFYDMTLSMKTTESDVXXDLYIRNILYILTMEITYQYTKVRCSFGRQ
PLFCEQGPEMCDSVAANEKEQKLYILRNPVHQPTQNTPFFSENHVNTIRA
EYSTSGANHAEGGWPKDVNVIDPEATQRYRRKVEKDDGYIHCVMSLSGGM
EHYVLQNNAIDMYETYYAEMSALPAVERNSMRTVNVYRDPSAPGAGRPVS
SVAWDPDGGHHFAVSYVDV
back to top