HiSeq10128 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10128
Unique NameHiSeq10128
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1357
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10128HiSeq10128_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10128 ID=HiSeq10128|Name=HiSeq10128|organism=Ostrinia scapulalis|type=mRNA|length=1357bp
GACTTCAACCGCACCCCGCGCGGCTCCGTCGACGCCTTCTTCTGGGATTT
GGAAAACGCGAACCTGCCGCTGCTCGCCGTCACGCCGCCCTGCACGCTGC
TCGACCTGCAGTACAACCCGCGCGACCACAACGTGCTGGCGGGCGCGCTC
GTCAACGGGCAGGTGGCCGTCTGGGACCGCCGCAAGGGCGGCCCGCCCGT
CAACACTTGCCCTCCCCACGTGGCCCATCGTGATTTAGTTCGAAACGTCC
TATTCATTTCTTCCAAATCCGGCCAAGAATTTTTCTCCGCCAGCCCCGAT
GGAGCGTGCAAGTGGTGGGACTGCCGCAACATGAACGACTACACGGAGGA
AATGATCATTGACTTGGTCAAGTCGGCGAATGACGTCCCAAATATGGCGT
CATCGTTCGGAATCAGCGCACTAGAATATGAGCCCACGATTCCAACGCGA
TTCATGGTTGGGACTGAGAATGGCTGCGTGATCGGTGGGAACCGTAAGGG
AAAGACGCCTCTGGACAAACTCCCAGGAAAGTTCGACGCCCACCTGGGCC
CGGTGTGGGCGCTGCGGCGCAACCCCGGCTTCCTGAAGAACTTCCTGACG
GTGGGCGACTGGACGGCGCGCGTGTGGAGCGAGGACTGCCGCGAGTCCGC
CGTCATCTTCTCGCCGCCGCAGCGCCACAAGATCACCGACGGCGACTGGA
GCCCGACCAGACTGTCGCTGATGCTGCTGACGCAGTGGGACGGGCTGGTG
TCGGCGTGGGACCTGCTGCGGCGCCAGCACGAGCCCGTGCTCACCATGCA
GGCCTGCGAGGAGCCGCTGCTGCGCGTCACCATGCAGGACGCGGGCTCGC
TGGCGGCTTGCGGCAGCCGCAAGGGCAACATCTACATGATAGAAATGTCA
CACAGCCTCACGCAATCGGACAAGAATGACAAGAGTCTGATGACTATTAT
GTTGGAGCGCGAGGCGAAGCGCGAGCGCATCCTGGAGGCGCGCCTGCGCG
AGATCCGGCTGAAGATGCGCCAGGCGGAGGAGGGCAGCCCCACGCACTCC
ATCGGCGAGCCCGACCCGGCCGTGGGCGACCGCGACCTGGCCGACGCCGC
CGCCGAGTACACGGCGCTGGTCAAGAAGGAGATGGCCAGCATGTGACCGC
CGACCGCCGACCTCGCGCACACATTCACGACAAATTGTCTGTCTTGTTGC
CTTGTCACGTTGTCACCAGCTGCAGGAAAAGCTTTCTAAACTTTACTATT
TACGCTTACAATACTTGATAGAAAATTGTATTAGGTACTTATTGTTTATA
GGTAGTTTTAATTTTCAATAAGTTTTTTTAATAGAATATTTGCATAGCGT
TGAATTT
back to top

protein sequence of HiSeq10128

>HiSeq10128_p ID=HiSeq10128_p|Name=HiSeq10128|organism=Ostrinia scapulalis|type=polypeptide|length=381bp
DFNRTPRGSVDAFFWDLENANLPLLAVTPPCTLLDLQYNPRDHNVLAGAL
VNGQVAVWDRRKGGPPVNTCPPHVAHRDLVRNVLFISSKSGQEFFSASPD
GACKWWDCRNMNDYTEEMIIDLVKSANDVPNMASSFGISALEYEPTIPTR
FMVGTENGCVIGGNRKGKTPLDKLPGKFDAHLGPVWALRRNPGFLKNFLT
VGDWTARVWSEDCRESAVIFSPPQRHKITDGDWSPTRLSLMLLTQWDGLV
SAWDLLRRQHEPVLTMQACEEPLLRVTMQDAGSLAACGSRKGNIYMIEMS
HSLTQSDKNDKSLMTIMLEREAKRERILEARLREIRLKMRQAEEGSPTHS
IGEPDPAVGDRDLADAAAEYTALVKKEMASM
back to top