HiSeq1013 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq1013
Unique NameHiSeq1013
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length254
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq1013HiSeq1013_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq1013 ID=HiSeq1013|Name=HiSeq1013|organism=Ostrinia scapulalis|type=mRNA|length=254bp
TGTGTCTTAAAGTAAAAGACACAGTATTTGATATCCTCCAAGCCATTTAC
TCTCGAATAATTGAGTTGACTAAAGTTGACGATGTTTTTCATCTGAGCAA
TGGTATATTTTCTTTGTCAAATTGTTATTATTTGATTGAAGATAGAGAAG
GATTTCTGGATAAGGCGTTAGAGAGATTGAAGTTGGCGAATAAAGGATTT
TTGCCAAAACTACCAATAGTCTGGTTCACCACACACTTGATGAGGGATCT
GGAA
back to top

protein sequence of HiSeq1013

>HiSeq1013_p ID=HiSeq1013_p|Name=HiSeq1013|organism=Ostrinia scapulalis|type=polypeptide|length=84bp
CLKVKDTVFDILQAIYSRIIELTKVDDVFHLSNGIFSLSNCYYLIEDREG
FLDKALERLKLANKGFLPKLPIVWFTTHLMRDLE
back to top