HiSeq10130 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10130
Unique NameHiSeq10130
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length948
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10130HiSeq10130_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10130 ID=HiSeq10130|Name=HiSeq10130|organism=Ostrinia scapulalis|type=mRNA|length=948bp
GCAGGAATTTTCAATTTTAGTTTTGATTTACACAAAAATACATCTTATTC
TGAAATGCAAGCCGAAGAAGTGGAGAGCGGTCTCTTTACTCCAGAAAATA
TAAAATGTGTTGAGATCAACAATTTTGCCTCTACCCCAAAGCATGAAAAG
AACTTTGTAAACGGTTTACAAAACGCTCGGCAACTGCTAGAAGGATTGCA
ACGGAGCCTTGCCAAGACCAGCAAGTACGAAGACCAGATGTTGCGCTGCA
AGTCAACTCACGCGCATTCCCACGCTTACTGGTGGGACAGCGACTTCTCG
GAGAAGGAACCCAAGAGTTCCAAAACAGAGATAAAACCAAGAAGTCACGT
CAACTTAGCAGAACCTTGGTCTACTACAAGCATCGTTTGTCTTCAGTACC
AGTACGAAGAGTTATCAAAGCGCTACGAATCCTTACTTCAATCCTACCAC
GATCGTTGCGCGGCGGTCGGTGAGCGGGATGAAGCCCTGGGCCGCCTCCG
CCGCCGTGTCAGAGATGCTTACGCGCATCTAACTCAGGCACATCGCACGC
TCATCGCTGTGGGGGACAAGTATTTGGATCTAAGCCGAAGGAAGCGGACG
CAAAAGAACAAATACGAACTGAAGATCAAGCATCTGAAAGCGACAGTACG
GGGCGTGATGGCCATGTGCGAGCACTCCAGGCTTCAGCTCGACACCACCA
TCGCTCGATACCTGGAGACCGAGGGAGAGGCTCCTAATGCCCAGTTGCTG
GCCGAGATAAGGAAATGCAATCTTCTCTTCTTGGAAAACTTGAGACTCAA
AGCCCAGATAGAAAAGTTGTCACCAGGCGAAGCTTTTTCGAAATAACTTT
AGAACCTTAAGTTTTAGAAACCTATCGTATTTTAGGAGTTTTACATGTAA
GTAATTTAGAATTGCGTAACTTATTATATCGTAGTTTGTTAATTTTAT
back to top

protein sequence of HiSeq10130

>HiSeq10130_p ID=HiSeq10130_p|Name=HiSeq10130|organism=Ostrinia scapulalis|type=polypeptide|length=62bp
MAMCEHSRLQLDTTIARYLETEGEAPNAQLLAEIRKCNLLFLENLRLKAQ
IEKLSPGEAFSK
back to top