HiSeq10133 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10133
Unique NameHiSeq10133
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length502
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10133HiSeq10133_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10133 ID=HiSeq10133|Name=HiSeq10133|organism=Ostrinia scapulalis|type=mRNA|length=502bp
ATTGTCTATTTCTTTTCCTTTTCGTGCGGCCGTGTCACCGCGTGGTTCAC
TGCCGCGTTTCTCAAAGAAACACTCAAAATGGCTATCAGACCAGTTTACA
GGCCTACAATCGTCAAAAAGAGGACGAAAAGGTTTATCCGCCATCAATCG
GATCGCTATGACAAACTTAAGCGTAACTGGCGTAAACCCAGAGGTATTGA
CAACAGAGTGCGCAGGCGTTTCAAGGGACAGTACTTGATGCCCAACATTG
GTTACGGTTCAAACAAGAAGACCCGTCACATGCTCCCCAATGGCTTCCGC
AAGGTCCTCGTCCACAACGTCCGTGAGCTAGAAATCCTGATGATGCAGAA
CAGGAAGTATTGCGCAGAGATCGCTCACGGAGTGTCCTCGAAGAAGCGGA
AGGTGATCGTGGAGCGTGCCCAGCAACTCAGCATCCGAGTCACCAACGCT
GCTGCCCGTCTCCGCAGCCAGGAGAACGAATAAACTTAAGTTTAATATAA
AG
back to top

protein sequence of HiSeq10133

>HiSeq10133_p ID=HiSeq10133_p|Name=HiSeq10133|organism=Ostrinia scapulalis|type=polypeptide|length=160bp
IVYFFSFSCGRVTAWFTAAFLKETLKMAIRPVYRPTIVKKRTKRFIRHQS
DRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPNGFR
KVLVHNVRELEILMMQNRKYCAEIAHGVSSKKRKVIVERAQQLSIRVTNA
AARLRSQENE
back to top