HiSeq10141 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10141
Unique NameHiSeq10141
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length900
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10141HiSeq10141_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10141 ID=HiSeq10141|Name=HiSeq10141|organism=Ostrinia scapulalis|type=mRNA|length=900bp
GACACTGACGTTGACATACGACGTAGGCGTTCCAAAGCACTCTTTGAACA
CTATTATGAACTTACACTTGTTGTTATCAGCTGTATATCATACAATTTCT
GGTGCTCGATGAGTTTGGAAAAAATCGAATATTGTCCGTGGTTTACGGTT
TACTTACAGCTGTTTTTGACATTGACGTTTAAAGGTCAAGATTACGAGCA
GGAGAACGAGTAGTTTTAGTTGAATTTCGTAGAATTTGTACACTATTTTT
CACTGTGTGGAAAACTTTGTGATTACACAAAAAGGAAGTCAGTTCCGCCG
TTTGTAAAACAATGCATTAATCGTTAAATAACTATGATTTTAAGTCGAAT
ACCGACGGCCTGCAGGCCTAGAAGTTATGTCACTATATTGTCAAACCAAA
TCACCACAGCGCCCGATTCAAAGTCGATACAAACTCCAAATCCAAAGAAG
ATTACCAGTGACATGGTAGGACCACCTGATCCTGTTTCAAACTTACGGAA
AATTATATTTAAAGAGCCGCCCAATGAAACCCCACTAGAAAAGCAGTACA
GGGAGCTACGAACAGAAGTACAAAGTTGGAATCATAAGTTCTGGACGCAA
CACAACACAAGATTTTTCCAGGAAAGAGAAGAATATCTGAAAAACAATTT
ACCAGAAGGCAAACAGAATTTAACGGCTGATGAAATGAGCGTCTTCTACA
AAGCTTTCCTGGACAAAAATTGGAAGGCACATTTGTCATATAATAAAGAA
TGGTACAAAAAAAATATAACCTTGTTAGGATTAGCATTACAAATTAAAAT
TAGGAAATTATTTAGAATAAAAGATTCAAAGTAAATCATATTAATTTTAT
TTTTGCATTTAACTTAATACTTATCAATAGATTTAATTTATAGGAAGATT
back to top

protein sequence of HiSeq10141

>HiSeq10141_p ID=HiSeq10141_p|Name=HiSeq10141|organism=Ostrinia scapulalis|type=polypeptide|length=166bp
MILSRIPTACRPRSYVTILSNQITTAPDSKSIQTPNPKKITSDMVGPPDP
VSNLRKIIFKEPPNETPLEKQYRELRTEVQSWNHKFWTQHNTRFFQEREE
YLKNNLPEGKQNLTADEMSVFYKAFLDKNWKAHLSYNKEWYKKNITLLGL
ALQIKIRKLFRIKDSK
back to top