HiSeq10144 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10144
Unique NameHiSeq10144
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length2480
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10144HiSeq10144_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10144 ID=HiSeq10144|Name=HiSeq10144|organism=Ostrinia scapulalis|type=mRNA|length=2480bp
AGTTACATTTCTTGATATTAACAGTTGACAAATAGATTTAGATAAAAGAT
GTTAGACATCGTTTCCTTCTTAATACTAAGTTTAATTACAATATTTACAA
AGTTACAATCATACGATTATTGTGGAAAAGTAAATTCGAGATACAATCTT
GATATTTGATCCTAAAAAATATGTCTCAACAAATATTTCACAGCCAGTAA
ATTAAACAAACGGAAAGTAATTCTTAAAAAACTACAATAATGTAGAAAAA
CTGTACAATTATGTATTTACATGTTCAAGCATTTCTGGTAATGCATTGTA
TGCCACCATATTGCCAAATCCTTTCGGCTCCTTCTTAGTTACAATAGTAA
CTATTTCATCTTCTGAAGGGGGCGGAGGGAAGTCGGCAGCAGCATCTACT
GCCGTCGTTATATCATCTACACTAAGAACTACATCCCTATTGTCAATTTC
AATCCTATTACGCTCCACTACAGAATTATCCTCCATTATACTGTACAAGT
TCTCCGACTTCCCCTTATTAAACATTTGTCAGGAGTTCATGTAAAACGGA
TCATTTAAATTAACCTCATCGTTGACTGTATTACTTTTTTGAGACCACTC
TTTCTGTTGATGCTTTATCCTGTAAATTATCTCGTCATGGATGACGCCGA
AGCACATTGCTGTCAAGGCCAACCCAGTCAGAGTATATCCAGAACAAAAC
CATAGAGTAGTAGAGTTGATTGTGTAATACCTGACCCCACTGATAGTCGT
GTAACTCATACCAGGGATGATATTACCGAAACCTATTGTACTTAAAGCCA
TAAAACAAAAATAAAAACCGTCTATGATACCCATACCATCTAATTTGAAT
AGGACCACAGCTCCTATGACTATGTAGATAAATATCGCAGAAAGACATAG
CAGAACAGGCGCTAGGATGCTTAAGCCATGCATTGACAGTTTTGAGTCAG
TGTCTGGCCAACTAATGACGTCATCTTTCGCTGTACTTGTAGTAGGCCTC
TCTGATATGGATAAGTCTTTCTGACTGTCAGGTTTTAATACATAGCACTC
TTCTGTTGGAGTTTTGCTAGTGTTCTGACTGTTGAGCATTTCTTCTTGTT
GCCTTTTAAGCTTCATTCTCCGTTCCTTCTCTGCCATTCGCCTTTCGTCG
TAACAGCAGTAGCCACAGTTGGAGCAAAGACAGCAACATAACGCTCGGCT
GAATACACTTCGAGCCATTTTAGATAGTAACGATCCGACACTCGAAAGGT
ACACCAAAGTGAGCGGTATACCGACGAGAGCATAAATAATCGTGACACCT
TTCCCGAGAATCGTTCTCGGAGCGATGTTTCCATAACCTATTGTAGTTAG
AACGGTTAGCGAGTAGAAAAATGCGAGCGCCAAATTCCATTCGTGCTCTT
CATAATGGTTGCTAGCGTCGCTCCCGGCAAATTCACCGAGGGCCATCTCC
CGGTAACTAACTCCGTACTGCGACGCCATTTCTGTAGTCACCCTCTGAAC
TAGCTCGTTTTGGAATTTTAAGATCTCTTGTGCAGCCAATCTAGTCCAAT
TCTCCCTATACAGAATGTTTAGTGAAACTGTTATTTCCCAGATATTTTCG
ACGGCTCTGCTCCTGGCGTCCCAGAAATAGTTGGCCGAAAGTGTCAAATT
ACCATACTCGTAATCGTCTTCAGGATGTTTCTTAGTGCTATTGTGCTCTC
TGTGGCTCGTTTTTTGCCTGTCCGGTAGCAACCGAGGCCTCGCCGGCACT
TCTACTCCGCCCTCAATGGCTAGGAATATAAACGAACCTAAAAACGTGTA
CGCCAACAAAATAGAAAATATCACAACGTTCGTAAGGGAGCCGATAATAA
ATTGTTTTCTTCTGTACTTAGTTGTTTTAAAACAAAAGCAACAAACAACT
TTCTGGCGCGAAGTTTGCGCTCTCTTTCTGCTATTAGATGCCATCGAGTC
GGCATCTTGGCATCTGTCCAAGGGTATCCCTCCATTAAGTGAAGGCTTTG
CCAATGTATACTGTTCGAATCGGTTGATTGCTTCTTTATCCAGTACAACA
TGATCTATATCCATCTTTACTCCGGTTACCTCCCACCTTCATCCAGTGAC
GTCATTATCCTTTCGTCGTCTATCTTATTTCCATGTCCATGTGTTGAAAA
TATTATTTATTTCAGTCGGAGTTCTCAGTTGGTTGACCAGTTTTCGATGC
TATTTCCAATTATCGCTGTAATCCTTAGTTGATTAGCGACGCAGGATTAG
TTGAAATCTTTGGCAGCCGTCCAGACGTATGGCTTGCACACTAAAATCCA
GCGGTCACAAACTCGACTCCGTCGTAACCGAAGAAATCACTCGGGTGATA
GTCACTTGTTTTTTTGTTACTCAAAAAGTAAACACTCACGGGTCACACAA
GCACAGCACTACACAACACGCACTCAGCACTATAGTTTCGTAATTCGATC
GTTTTTAGGCAACGGACAGACGGGTACGTG
back to top

protein sequence of HiSeq10144

>HiSeq10144_p ID=HiSeq10144_p|Name=HiSeq10144|organism=Ostrinia scapulalis|type=polypeptide|length=375bp
MXNLTLSANYFWDARSRAVENIWEITVSLNILYRENWTRLAAQEILKFQN
ELVQRVTTEMASQYGVSYREMALGEFAGSDASNHYEEHEWNLALAFFYSL
TVLTTIGYGNIAPRTILGKGVTIIYALVGIPLTLVYLSSVGSLLSKMARS
VFSRALCCCLCSNCGYCCYDERRMAEKERRMKLKRQQEEMLNSQNTSKTP
TEECYVLKPDSQKDLSISERPTTSTAKDDVISWPDTDSKLSMHGLSILAP
VLLCLSAIFIYIVIGAVVLFKLDGMGIIDGFYFCFMALSTIGFGNIIPGM
SYTTISGVRYYTINSTTLWFCSGYTLTGLALTAMCFGVIHDEIIYRIKHQ
QKEWSQKSNTVNDEVNLNDPFYMNS
back to top