HiSeq10145 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10145
Unique NameHiSeq10145
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1253
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10145HiSeq10145_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10145 ID=HiSeq10145|Name=HiSeq10145|organism=Ostrinia scapulalis|type=mRNA|length=1253bp
GACATAATACCTTGACGTGCGGGTCAACCGGTGCGCCGGCGCACTGGCAT
TACGCCCAATGTCGTCGATTCACGAATTGTCCACACTCTACCCGTGACGA
CGTGCCCCCCCAAAAACATGATTGTTACATCCGTCTCCATATCTAGGTTT
ATGTAGAAATACCTTGTCGCAATCGTAACTAAAATCGGCATTATAGCATT
TGATACGATTAAAGAAAGATTAGTATGTAGGCTATGAATCAACTCTTATT
GCGGGAATTGGCTGGTCAATTTGGCTCGGTGGTGGGAAGCTATCAAGCTA
TGCAGTCGATCGTGCGTCGCGCGGGTTTTGTGTCGCGAGCCTTTCTTTTC
TGCATCTAGTTTCCGAGCGACGTCGCGGCGCATACTCGCCTCGCGCTTCA
ACTCTTTGAGAAACTGCAAATTAAGTACGGAGTTAATTAAATCGGCGGGC
TCGTCAAGCGGTCGGCTGCACACAATACCGAGGAATGTTTCCGCAGTTCA
TACGCGCCCATCAAACCGGACTGGTGTGTGTCGGCAGCGCGCTACCAAAA
ACAAACGATTCTTGTTTATAAGCAGTCGCGACCGACGGCGTTCAGTGTTT
GATTACGAAACCTTGTAATCGCGTGGGTGATTTCTAAATTGGGCTCTGGC
AATTGTGATGTGGACGTAGTGTTTTTGTGGTGCATCACTTGTCGCCCTAT
TCGCCATTAATGTGAACAGACTAGTGCGGATCAATGCAGACTATGAAATG
GATAGAGATGGTGCGGCTCGGGCCCACGGCTGCGGAAAGGCCTGCCACTT
TCGACGGTGATAAGGTGAGCGTGTCAAAACACCGTTAGCGCTTCCACGGC
GCACCTCGCTGCCGGCTTTTAGGCGGCTAGATAAAATAATCATTATCCAT
TATCAACGAATTATCAAATGTCTGTTGGGCATTTATAATAACCTAACTAC
CCACACTGCCTATACAGCTATGATGTGCGTGATATTTGGATTTTATTGCA
AATCCAAGTATTTTATAATTTGAGTTCATCAAAATCCATAAAACTGGGCA
TCGTGAACAATCAGCATTATTCTGTAATGATGTTTGTTATAAAATGTCAG
TATGAAATATGAATGCCGAGATCCGCAGACCTTATGACGTCTTGACATTG
AACTCAAATGTTATCATCATGTACTTAATCATTCAGCAGTTATAATATAT
TTTTAACAACATAAGGAACAAAAGTATTTTGTATTTCTTACCTGCATAAG
CTG
back to top

protein sequence of HiSeq10145

>HiSeq10145_p ID=HiSeq10145_p|Name=HiSeq10145|organism=Ostrinia scapulalis|type=polypeptide|length=31bp
MKWIEMVRLGPTAAERPATFDGDKVSVSKHR
back to top