HiSeq10146 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10146
Unique NameHiSeq10146
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length705
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10146HiSeq10146_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10146 ID=HiSeq10146|Name=HiSeq10146|organism=Ostrinia scapulalis|type=mRNA|length=705bp
CTTAGTAGTTTTTATTTATTTAATCGTACTACATTATTATTAAGGAGTAA
CAATATTAACACAATTTTTGATCATCCTCATGAACTCGGATACAGAAATA
AAGCCATCGTAGTCTTTGTCAGCATCGTCAATCATCTCCTCTATTTCCTC
ATCAGTCAAATAAGTTCCAAGGATTTGAGTGACTTCTTTCACGTTTTCAA
AACTTATGAGACCACTGTCATCTATATCAAATAGGCGGAAGCTTTTCATT
ATGTCTCCATCGCTGTCTTGTGACATGATTTTTCTCATTATTGCCGTTTC
AAAGTTCTCAAAACTAAGCTTCCCTGTGTCTCCTTTATCAACGCCTTGCA
CCATTTGTTGCAGCTCCTCTTTGGTTGGTTCATAGCCGAGAGCTTTAATA
GCAACACGAAAATCTTCAGCTTTTATTTTCCCTTCACCAGTGTAGTCCAG
TAGATTGAAAGCTTCACGCAGATCATTTTCCTGCTCAGAAGTGAGTGTCA
GTTTAGCCTGAAGCTGATTAAATGTTGGTGATTTTTGCAAATCTTCTATT
TCTTTTTCGGAAAATTGAGCCGTCCCTGATAAATCCTCAAGATCTGTGAG
ATCCATTCTTTCTTTTATTATAACAATCTTACTTTTGGTACATGTAGTTA
AATACAAACAACTGATCTATTTGGCTGCGTTGCTATGCTAACAAAAGGTA
GGTGC
back to top

protein sequence of HiSeq10146

>HiSeq10146_p ID=HiSeq10146_p|Name=HiSeq10146|organism=Ostrinia scapulalis|type=polypeptide|length=201bp
MYXKSKIVIIKERMDLTDLEDLSGTAQFSEKEIEDLQKSPTFNQLQAKLT
LTSEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQ
GVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFE
NVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVT
P
back to top