HiSeq10147 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10147
Unique NameHiSeq10147
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length814
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10147HiSeq10147_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10147 ID=HiSeq10147|Name=HiSeq10147|organism=Ostrinia scapulalis|type=mRNA|length=814bp
CTTAGTAGTTTTTATTTATTTAATCGTACTACATTATTATTAAGGAGTAA
CAATATTAACACAATTTTTGATCATCCTCATGAACTCGGATACAGAAATA
AAGCCATCGTAGTCTTTGTCAGCATCGTCAATCATCTCCTCTATTTCCTC
ATCAGTCAAATAAGTTCCAAGGATTTGAGTGACTTCTTTCACGTTTTCAA
AACTTATGAGACCACTGTCATCTATATCAAATAGGCGGAAGCTTTTCATT
ATGTCTCCATCGCTGTCTTGTGACATGATTTTTCTCATTATTGCCGTTTC
AAAGTTCTCAAAACTAAGCTTCCCTGTGTCTCCTTTATCAACGCCTTGCA
CCATTTGTTGCAGCTCCTCTTTGGTTGGTTCATAGCCGAGAGCTTTAATA
GCAACACGAAAATCTTCAGCTTTTATTTTCCCTTCACCAGTGTAGTCCAG
TAGATTGAAAGCTTCACGCAGATCATTTTCCTGTTCTAGGGTAAGAACTA
GTCGAGCACAAATGGTTTTTTCCTTCTCTTCTGGTTCAACTTCTGCATCT
GCTTCTCTTTCTGCCAAGTCTTCAGCGGGATTCATAACGTAAATTTAGTG
TTCAGAGAACACTACAAAAATAGAAAAGAATAATAATAATTTGAAAATAA
TTTAAATTGCTTGTAACTGCTTGTAACTTTATTAACTTTTCTGCAGACAA
AATTGCTTGATAAAAAAGATAATTCTGCAGACAGTGACAACGTTTATGTC
ATTTCTTGACTTGTCAAGATTTTAGACAGAATTTTAGAAATTATTTGGCC
AATCTGAAATAATG
back to top

protein sequence of HiSeq10147

>HiSeq10147_p ID=HiSeq10147_p|Name=HiSeq10147|organism=Ostrinia scapulalis|type=polypeptide|length=181bp
MNPAEDLAEREADAEVEPEEKEKTICARLVLTLEQENDLREAFNLLDYTG
EGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIM
RKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEE
MIDDADKDYDGFISVSEFMRMIKNCVNIVTP
back to top