HiSeq10150 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10150
Unique NameHiSeq10150
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length403
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10150HiSeq10150_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10150 ID=HiSeq10150|Name=HiSeq10150|organism=Ostrinia scapulalis|type=mRNA|length=403bp
GAATTTCAAAAATTCATTGTTGTTCTGTTGTAGGAGGGTGCAATTTGAGT
TAATAAATTAAAATGAATAAGCCACTGAGCGCAGATGATATTGCTGCCAT
AGAGAGCCAGTTGCGGAACTGTGTGGCGGAAGACAGAAAGCACTGGCAGA
TCAACGATGTGAAATGCGATGCCATTCACACTGCCAAGTCTTATGAGGAG
TTCGCGGACCGTGTAGCTGCAGCCCACTTGCGACCTTTGGAGAAAAGTGA
CTTTAAGAACAAAGCCAAGAGGAGCTGGAACCAGTATGCAGCGAAAGAAA
AGGAAGACCAGGAATAGTGGCATTTTTTGAGTTGTTAGAGTGCGGTTCTG
TAGGTATTTATTCGTAAAATAAGCGCCATGTTAAATACAGAGGTGTTATG
ATT
back to top

protein sequence of HiSeq10150

>HiSeq10150_p ID=HiSeq10150_p|Name=HiSeq10150|organism=Ostrinia scapulalis|type=polypeptide|length=84bp
MNKPLSADDIAAIESQLRNCVAEDRKHWQINDVKCDAIHTAKSYEEFADR
VAAAHLRPLEKSDFKNKAKRSWNQYAAKEKEDQE
back to top