HiSeq10151 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10151
Unique NameHiSeq10151
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length545
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10151HiSeq10151_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10151 ID=HiSeq10151|Name=HiSeq10151|organism=Ostrinia scapulalis|type=mRNA|length=545bp
TAGGCAATATCAACAATTTCAGACGGTCTTTACCATTATTGGTCTAAAAT
AACTCAATTGTTTTAATTACTACTTTGTTTTGGTCTACCTAATGTTATTG
TTTATGAAATAAATGACTATGACTATGACCTATCTGGCATAGAGGAATTA
TTTCATTATCTAAATAAGCTGTCTGGAGGGTGCAATTTGAGTTAATAAAT
TAAAATGAATAAGCCACTGAGCGCAGATGATATAGCGGCCATGGAGAGTC
AGTTGCGGAACTGTGTGGCGGAAGACAGAAAGCACTGGCAGATCAACGAT
GTGAAATGCGATGCCATTTACACTGCCAAGTCCTATGAGGAGTTCGCGGA
CCGCGTAGCAGCAGCGCACTTGCGACCTTTGGAGAAAAGTGACTTTAAGA
ACAAAGCCAAGAGGAGCTGGAACCAGTATGCAGCGAAAGAAAAGGAAGAC
CAGGAATAGTGGCATTTTTTGAGTTGTTAGAGTGCGGTTCTGTAGGTATT
TATTCGTAAAATAAGCGCCATGTTAAATACAGAGGTGTTATGATT
back to top

protein sequence of HiSeq10151

>HiSeq10151_p ID=HiSeq10151_p|Name=HiSeq10151|organism=Ostrinia scapulalis|type=polypeptide|length=84bp
MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADR
VAAAHLRPLEKSDFKNKAKRSWNQYAAKEKEDQE
back to top