HiSeq10154 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10154
Unique NameHiSeq10154
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length834
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10154HiSeq10154_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10154 ID=HiSeq10154|Name=HiSeq10154|organism=Ostrinia scapulalis|type=mRNA|length=834bp
GTTTTTATTCTTATAAAATAAAGCATCAGTTTATATGATGCCGATCTTGT
TGGCGACATCTAGTGCGTCGTAGTCCCTCGCAAGCCGTACGTACGCCTTC
TTTTTACCATCGGGCCTGATCAGGGTGTTAACTTTAGCAACATTGATGTC
ATATAGCTTCTTCACAGCAGCCTTAATGTGGTGCTTGTTGGAACTGGTGT
GGACAATGAATACCAATGTATTGTTGTCCTCAATTTTCTTCATTGCCGCT
TCAGAGGTCAATGGGAACTTTATGATGTTGTAGGCATCCATACGATTCCT
CTTGGGCAATGATTTCCTAGGGTACTTAGGATGTCTCGGGGGCTCAAAGG
TCTTGGGCCGACGGAAATGCACTGATGTGCGGATTTTACGCACACGCTTG
CCATGTTCTCCCTTGACAACCTTCCTCTGTGCCTTCAAAGCCTTGACAAC
AGGTTTGACCACCTTCTTCTGTCCTTTGATGCCAGTCTTTTTGGGCTTGG
GTGCTATCTTTAACTTGGCAGCTGCAGGTTTAGGCTTCGCGGGCTTAGAG
GCCGCTGCCGCTTTCTTGACTGAAGGTTTCGCACTTGACTTGGCCTTGAG
TGCAGCAGCTTTAGCTGAACCTGGCTTGGCTGTAGGTACTGAAGTAGCCT
TCTTCTCCGCTGGCTTGGCAGCAGGAGCCGACGCTGGCTTAGCTGCAGCG
GGCTTGGCAGCAGCGGGGGCAGACTTGGGAGCAGCAGCTTTAGGTGCTGG
TGCGGGTGTTTTGGCGGATGCTGGTTTAGGTGCACTCGTGGTAGAGGCAG
CCTTAGGTGCCGCTGCGGGAGTTTTAGCAGTGGC
back to top

protein sequence of HiSeq10154

>HiSeq10154_p ID=HiSeq10154_p|Name=HiSeq10154|organism=Ostrinia scapulalis|type=polypeptide|length=267bp
ATAKTPAAAPKAASTTSAPKPASAKTPAPAPKAAAPKSAPAAAKPAAAKP
ASAPAAKPAEKKATSVPTAKPGSAKAAALKAKSSAKPSVKKAAAASKPAK
PKPAAAKLKIAPKPKKTGIKGQKKVVKPVVKALKAQRKVVKGEHGKRVRK
IRTSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNIIKFPLTSEAAMKK
IEDNNTLVFIVHTSSNKHHIKAAVKKLYDINVAKVNTLIRPDGKKKAYVR
LARDYDALDVANKIGII
back to top