HiSeq10155 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10155
Unique NameHiSeq10155
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length4649
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10155HiSeq10155_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10155 ID=HiSeq10155|Name=HiSeq10155|organism=Ostrinia scapulalis|type=mRNA|length=4649bp
GTTTTCAACCTCCTCATAATTAAGTGAATATAACCATTTAGTTAAGGTTT
CCTTGCAAGTATGAGTTATCATTGGGTAAATATTCAGTAATTTATTAATT
TTATTGTAAACAAAGGCAGACTGGCTCAAATATTGCCTTGTGGCAAAAAC
TGTACGTATTGTGGGGGCAGGCGCAACAGCATCTTTCCTTCTCTTGTGGG
TAAGGTCGACATGAGTTAAAGATTTATGGCATTTCAGTACAAGGTTCAAA
ATATAAAGTTTCCTAATTGTAAGTAGACCGCTAATTTGATATAATTTATC
CGTAGGAAAACGGTAAGGTTTAGAATACATGACCTTGATGAGGGATCTCT
GAGCTCTTTCTAATTCAAGAGCGTGGGTTTTGCCTGCACCACCCCAGATT
GGGATACAATATGTAAGTACTGACTGAGCTAGGGCTATGTAGATTTTGTT
GTTTAATTTATTTGTCATGACCTGTCTCAGAGACTTAAAGACCCAAGTGA
GCTTTCTGGTTCTATTGATTAAGAGCTCCATGTGTGGGTACCAACTGAGT
CGCTGGTCAAGTATAACACCCAGATATTTGGTTTGATTGACTTTATCTAT
AGGGGGACAAGTACAGTTCAAGTTACCAGGGTTTTGACAATTGTGAATTT
TTATTTGAAAATTACTGTTAGGTTGTGATTTGTTAGATGGAGTAAAGCAA
ATATAATTAGTTTTCTGGATGTTTAATGTTAGGAGGTTATCTCTGAGCCA
GTTGAATATGATATTCAAGCCCCTCTCAGTCCGTACAAGAACTTCATTCC
AAGTGTTGCCAGTAAACACCACAGCAGTATCATCCGCATAGGAGAAAATC
CTCCCCCCAACATCCCGGAGATTACATAACTCGTTTATATATATTAAAAA
GAGTGTTGGGCCGAGGACACTTCCCTGCGGGACTCCGAAGTTGACTGTTG
CTTTTTCACTGATGAAGCCGTCAATTTTTACTTCCTGGGTTCTGTCCTCC
AGGTAACTTTTAAATAGTAGGAGTGGAGTGCCTCTTATTCCTATATCCTC
AAGCCTGCGCACAAGAATAGGCACAGAAACGGTGTCAAAAGCCTTTTTAA
GATCCAAAAAGACTGTAAGACATTTGTTGCCTCCGTCAACCTCTTTGACT
ATTACTGAAGTAAGATCTAAAATGGCATCTTGCGTCGAGAGACCCTTCCT
AAAACCATATTGTGAGTTAGATAGAATTTTAAATTTATCAAGAAAACTAA
CCAATTTATTATTTAGTATTTTTTCGATGATTTTGGAGATTGAGGTAAGT
ACAGAGATAGGTCTGTAATTGTTTGCATCCGCTCTGTCCCCACTCTTGTG
CACAGGGGTGACTACTGATCTCTTTAGTGAACTGGGGAAGACGCCCATCT
TGAAGCAAAGATTAGTGAGACTACAAATGTGGGGAACAGTAAACAATCTA
GCATGCTTTAGGAAGGCCGTGCTAATATTGTCCCAGCCAGGTGAGCTACC
CGAGTCTAGGTTCATAAGGACTCTTTCTACTTCCATTACATCGGTGTCCA
GCAGAACAAAAGATGAAAGGTGGGTATGATTAGAAATACTATCAAGAGTA
CTGAAGTCTCTATGTCTGGATTGCTTTGTAATTATGTCTGCTAGGTTTGC
GCCAATACAGACGAAGAAATTGTTAACAAAGTTGACTGAGGCCTGAGGTT
CGGCTTTTGTTTCTAATAGGGCTACATTATTAGTTTTTGGCGCTTTATAT
TTAGTGATTTCGTTGACCGTTTTCCAAAATTTACGTGGGTTATGAGTAGT
TTTGTTAATTAAATCTCTATGGTATAGTCGCTTTAGTTTTTTTATCAAAT
TTGAGCAATAATTACGAAAACGTTTGTAGGTGATTTTCAAAATAATATTG
TGGGGGTCTTTTTCAAGCTTCAGTTGCATTTTATTTCTGAGTTGAATGCA
TCTCAGTGCGCCAGCAGTTATCCAGGGCTTTAATGTCCTTTTATTATTTG
AAAAGTAAATCTGCTTAGAGTTCGCTTTTATTGCAGACATAATCATGCCA
ATAAGTGAGTCAGCATAATCCTCAGGATCAGTACACGTTTCTAAATAGGT
ATTATCGGCGGATGTAAGGGTTTTTAAGGTTCCATCAAAATCGGTAAATA
ATTTAGATCTAGTTAAAGGTTTACAAGCAGTAGGGTTAGATAAACTAAGT
AACACCGTGTTGTGGTCGGTAATTGTAGTGTTAACGACAGCTACGAAAGC
AGTATGAGCTTGGACATCGAGTTTCAACATAATATGATCCAGACATGAAC
CCTTCCTCGTAGATAGATTGTGCCCAGGTAAGATACCATGCAGAGACAGT
ACGTCTAAGTAACTAAGCCTATTACGACGATATTGAGGCTTTTCTTTGTC
AGTTGGGAGCAGGTTGATATTAATGTCACCAACGATAGATATATTTTTAT
AATGGCTAATAGTTTCTAAGTGTGTGTTAAGTGAGCTAGTAAAATTATCA
GCATTTAGGAAAGAGGGAGAACGGTAAATGCCCAGGAAGACATAGTTATC
TATTAATATCTGGAGCCCAGTGGCATCTGAAAGGTGTAAGTCAGTAACCT
TTGCCCTGTGGTTGGTTTTAATATAAGCAACAACACCGTCATTTTGATTT
AAGAGTTTAGTTGATTGATAAGAAGTATAGTTGTCGATGGATGGTATATT
TTTATTTAAGTCTAGTCTACATTCCGTGAGTATTAATATATCAATTTCAA
AATTTAGCATTGAGAGATTTAGTTGTAGATCGTCCAAGTTCTTATAGATA
CTTGCAATGTTCTGGGTTACCACTGTTAAGTTTTTATTAGTCATTAGTCT
TTGGCAGTGGCTAGTCAGATCTTTCATATTGCAGCTAACAGAATGAGATA
TTTGCATGCTGTCTAATTCTTGAGAGGCATGGCGTTGACTATCCATACAA
TAAATATTCAAGACATAGGACATTACTGGAGTTGTTCATAGATGTAAAAT
AGATTAGTATTTTAAGAGACAGTTTCCAATCTGTGTCCACGAGTAAATAA
GCTAAGTTATACTGTGTGCATGATTTTTTCAGAGTAAGTATTTTTAGTGT
TTGTGTGAGTGTGAGGTGGGTGTATGTGGTTATGAATATGTATGAGAGTT
GGGGTTTGTAAATAGTAATAGTGATGTGTAGTGTGAGTGAAAGTATGTAA
AACGAGCTTACAATAGTTTTAGTATTTATGAGTAATATATTACGAAAAGT
TTCAAAATAATACATGCAGTTGCAGTAGTATGTAAAATATGTAAAAGGCG
AAATCGCTAAATATAGTCAGGTTTCTTGCAGGAGCTGGTTTACCTGGGCC
TCATGCTGAATACAGATAATTTTGGATTGATCGTCTTTCCTCACCAGAAC
TCTTCCAAAAGCAGTCCAGCAGTACTTAAACTTGTTTGATCTGACGAGGT
CTCGAGAAAGGAAGAACAGCCGAGCACCCTTAGCAGTCAGCTGCTCCGAT
ATAAAGACCGGGGAGTCCGCACTTGTAGTGAATCCAAGATGTTTTGCTTG
TAGTTTACATTTATTTTTGATGTTAAACTCTTTTGTTTTCTTTAAAAAGT
CAGTTTTGAGGATCGTGGACCCTAGCTCCACAATGATAGGAGGGCTGGTC
TCCCTGTCATTACGCACCTTTAAACGATATACATCTTTTATGTCCCGCGC
AGACAAATCGAGGTTTATAGTTTTCGAGAGGCAGGTTATCATATTAATTA
AGTCACCCCTGTTTTCTGAGGGTTTGCGGGGGACATTTTTTAACTCAAGG
TTCGCTTTACGGGATGTCCTCTGTAAGTCCTCTAGTTTTTCTTCTAACGT
ATTTATATACTCCCGATCCTTTTTGGCCTGAGTTTCCAGTTTTTCTATTT
TCTTATGGAACTCCTCGTTCTGTGTTGTTAACAGGGAAATGCTCTGCTCG
ATGCTAGATGTCGTTTGCTGAAGGGATTTTAGTGAGTTTGTGATGGCCTC
GCTAGACTTTTGTTGTACACCGATAAATGACGTCATAAGCTTAGTCATCT
CTTGTTTAAAGTCATCGAACTGGGACGGTGATAACTCCTCTTCTCGCGGC
CTTCTATTTCGAAGGAAAACATAGCTAGGAGGAGTGTGATCGTCCTGGAC
TGCCGTTAAGGCCTGGGGCTCGGTCTCCAAGTCGGCCTTGGGATCAGTTT
GTTGCCCTAGGGCACCCTCTGTCGATTTTGTAGGTGGTGGCGTCCGTTGA
GTCGACATTATGCACTCTGCGCGTAGGCCTAAATGTGAAATAAGCCGTCG
GGATAATGTTCTGTGGTGGGCGGAGCAACGAGTGCACGGCAGCGCGTGAC
GTATTGAGATGGGCAGGGCTGACTAGTGCAATGGGTCGGTGGGCGGGGCT
AGTCAGGCCGGTTGCGCTGGCGCAGGGCTTGATTAATTATGGTTGTCTTT
ATCGCACACGGGGTCTTCACTTTCACTCACAGGTGGCGCACTCGCAGACA
CTTATGATCGCCTGGTACTTCGCGTAGAATTATTTGAAAACTTATTTATT
TAAAATTGCGAAAACAAATTAAATGCGGATCGCTTAGTGAACACAGCCGC
ACTGTACGGCGTCCGGAAGGGAAGAGGTCAAATAGATAGTTATCATAAT
back to top

protein sequence of HiSeq10155

>HiSeq10155_p ID=HiSeq10155_p|Name=HiSeq10155|organism=Ostrinia scapulalis|type=polypeptide|length=73bp
MFCGGRSNECTAARDVLRWAGLTSAMGRWAGLVRPVALAQGLINYGCLYR
TRGLHFHSQVAHSQTLMIAWYFA
back to top