HiSeq10156 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10156
Unique NameHiSeq10156
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length938
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10156HiSeq10156_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10156 ID=HiSeq10156|Name=HiSeq10156|organism=Ostrinia scapulalis|type=mRNA|length=938bp
ATAACAAATTCTAATTTCAATAAACAGTAACAAATAGTTAACTATTAAAA
TTCACAGATCAAAAATTAATAAATTATTTTAATTTTAAAACTAAAATTTT
CATATCAAGCATTTGATACCAATAATTTGCTATAAACAGTGTTGAGTATC
TCTTCTTTGATCTTTGTATCTAGTTCATCAGATTGACAATCAAATACTTT
TTCAAAGTTACGTAAAAACAATGGAGTCATTTTGTCAATAGAGCATAAAA
CACCAGTTTCTTTAGTGAGAGAGGTAACACCTTTATCTTCTATACCACAA
GGATCAATGTGGTCAAACCAGCTGAGATCATTATCACAGTTTAGAGATAT
GCCATGTGTTGTGACATACCTGGAGGCATGGATCCCGATGGCAGCTATTT
TGTTATCATCTACCCACACGCCAGTGTGTGGTGACCTTTTAGCTTTGATA
CCTAAATCACCACACATCCCAATGACCGTTTCTTCCAAACTATTGACGTA
CCACTTGACACTAGTTTTGAAGTGCTTCAAGTTTATGACAGGGTACGCTA
CAAGCTGGCCGGGACCATGGAAGGTGATCAGCCCACCCCGGTTTGTTTTT
CTGAACTCTGCTCCAAGTTCTTGGAGGCGTACTATTTCATTTTTGGGAGT
ATCATCTCTAATACCCACGGTATAGACTGGCTTGTGTTCGACAAGTAGAA
GAGTATCGTAATTGGTTTGTACTCCCTTCACCATTCCATCGAGGTGCTTT
CGAGCTATAGCCAGTTGGATTTTCTGGGCGGTATCATAGCTCATCAGTCC
TAGTTTCCAAACCTTAACCATTTTGAATTAGTTCTATTTTTAGTAAGTTA
TGACTTCCTTCAAAAGATGATCAGTAACATGTATGTATTTTTTATTTAGA
TTTTTGATTTTTTGCACTTTTTCTGTAAATTTTGAAAA
back to top

protein sequence of HiSeq10156

>HiSeq10156_p ID=HiSeq10156_p|Name=HiSeq10156|organism=Ostrinia scapulalis|type=polypeptide|length=238bp
MVKVWKLGLMSYDTAQKIQLAIARKHLDGMVKGVQTNYDTLLLVEHKPVY
TVGIRDDTPKNEIVRLQELGAEFRKTNRGGLITFHGPGQLVAYPVINLKH
FKTSVKWYVNSLEETVIGMCGDLGIKAKRSPHTGVWVDDNKIAAIGIHAS
RYVTTHGISLNCDNDLSWFDHIDPCGIEDKGVTSLTKETGVLCSIDKMTP
LFLRNFEKVFDCQSDELDTKIKEEILNTVYSKLLVSNA
back to top