HiSeq10157 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10157
Unique NameHiSeq10157
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1649
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10157HiSeq10157_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10157 ID=HiSeq10157|Name=HiSeq10157|organism=Ostrinia scapulalis|type=mRNA|length=1649bp
AGACGAGCGGTCGTGTGTACAACAGTATTCTAACGAGCTTTTAAAATTTA
CAAAATTTAACAAAGCATTTAAAGTCAAACCGTGTGTGTGAAACTGTGAA
AAAAAAAAGAATAAAAAAAAAAAATAAGAAAATAATAAATCATAATGTAA
TCAACGGCATAATTAAACAAAATTAAAAGATGTCCAAAGGATTTTTTGTC
AATGTACGATAAGCAGCAGCAGATCTTGCCGCAACTCGTCAGACTCCCGC
GACGCGTCAATTACCACAGCTTACACAACTTTTTATATAAAACTGCTGCT
CCATCGTTGGTGCCGCTAATTCTCTAAGTAGTGAACATCGCATCACGACA
AGCCGCGGGCCAGTTATAGCATGAGGTTAGCCTTGGCGGTCGCGTTGTTA
ACCCTCGTTACGGTAGCTTACACGCGCCGTTTACCACCAGCTAAATATGA
ACGTCTCGAAGAGAAACCGGTAGCATCAGACCAGGAACCGTCCCCCAGTG
ATCACAAAAAGGAACAGCACCATAACCATGAGTACAAGAAGGGTGGAGGT
AAAGAGCATCATGCGCATCATCACCATGACCACGGAGAACACGGACATAA
GGGTTATAAGGGCCATCATCATCACGAGGAAGGCAAGAAGGGACACCACG
ACAAAGAACACCACAAAGGCGAATACGATGACCACGGTGGTCACAAGAAG
GAGCATCACCATCACGATGGTCATTACGACGAGCACCACAAGGGCGAGAA
AGGTGAGAAAGGACACAAATTCGAAGAAAAGGGACACTACAACAAAGGTC
ACTCGACTAAGGGACATCATGAAATTCATAAGCTGGATGAGTTCAAGAAA
GACAAACACTTCTTCGACGAGGAAGGAGACTCCGGTCACGAGGAGAAGCA
CGGAGGGTACCATGAGGAACACGGCCACAAGAAGGGAGGACACTTCAAGA
AGGGTCATCACCACGGGGGCCACCACGAACACGAGCACGGCGAGAAGGGC
CACCACGAGAAAGGAGGCCATCATCACGAGCACAAGGGCCACAAGGAGGC
TGCCGGTCACGATGAGCATCATCATCATCACCACGACCACGCCAAGAAGG
GTGGTCACGAGCATCACAAGAAGTATGGGTACAAGAAAGGCCACTAGAAG
CTTGAATATCGCTGATTTAATTGCATTCGAGAGAGATAGGCAGAATGGTC
TCGATGTTACGATTTTGTCAATGTTTCATAAATCATGGTCGTTACTCAAC
CAATTGCTGGTGGCTATTGCAGCTGGCCATTTCTTGCAAATCGTAACTTA
CAAACTGTGATTTAATATTTTATTTACCTACCTAAAATATGTGTAAATAA
TAAAAAGGTTAAATTATTTTTGGTATAAGTAAACTAAGTTATTATTTGTT
ATTTATGTGCTTATTTTTTCAATGTTTTATACAATTATATTACATTAAAA
CTTGTGTGTTTCTTTATCATTACTGTTTTGGTAAACAATAAGAATCAAAG
TGAATAAACTATTCGTAAGTATCAAGGTTAGGAGGGCATGCGACCACTGG
CTTTGTAGTTTGGAGCGAGCGGCTAAATTGTACAATACACAAAATAAAAC
AAGTATTTAGTTAAATTAAATCTCATTTCTACGCTCACACAGTCCCCTT
back to top

protein sequence of HiSeq10157

>HiSeq10157_p ID=HiSeq10157_p|Name=HiSeq10157|organism=Ostrinia scapulalis|type=polypeptide|length=258bp
MRLALAVALLTLVTVAYTRRLPPAKYERLEEKPVASDQEPSPSDHKKEQH
HNHEYKKGGGKEHHAHHHHDHGEHGHKGYKGHHHHEEGKKGHHDKEHHKG
EYDDHGGHKKEHHHHDGHYDEHHKGEKGEKGHKFEEKGHYNKGHSTKGHH
EIHKLDEFKKDKHFFDEEGDSGHEEKHGGYHEEHGHKKGGHFKKGHHHGG
HHEHEHGEKGHHEKGGHHHEHKGHKEAAGHDEHHHHHHDHAKKGGHEHHK
KYGYKKGH
back to top