HiSeq10159 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10159
Unique NameHiSeq10159
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length2952
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10159HiSeq10159_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10159 ID=HiSeq10159|Name=HiSeq10159|organism=Ostrinia scapulalis|type=mRNA|length=2952bp
CAAATAGAAATTGTGAAAGGATTCGCTGTGTCCATAAATCTCAATTTCGA
TCGTGCGACGTCCGACTTCTTTCGCGGCGCGTTTTAGATGCTTTCGATTC
GAATAAAAGTCGAACTTCGAAAAATTCCAATATTACATATTTACTTATTA
CGAATGCATTAAAATTGCTGAATAATAATTAGCCGTTCACGGATTATCCA
CCATTTTCACAGTTTGCCGGAATTACAAAACGCATAACCATGTTATAACG
CAGGTGAGTGTGTGAAAGGCCCTTTGCCCCTCCTACAAGTGTACGAAGGT
AAGCACAGATAGTGGAAGAAACACTCCATAGTGTTATTTTGCACCTGACT
ACCAAAATAATTTAATAACATGGTGGATACCTACTTATGTCCATGAAAGT
ATTAATGTGGTTTCAATTATTTTATTTAATAATAAATTTTAGCTACATGA
AATGTAATTAAAACCTATTGGAAGTTAGTTTATGAAATCAGTCTTTAGTG
AATTTCAATATAATTATTATTTTCCGTAATGTATTTCATTAATTGCATAA
ATTATTATGAACACAATATGATTGAACTATGTCTAATATATCAACCAGAT
TTAAATAAATATCATGCATGTATATGTTACATGCAAAATCAGATCAGCAG
CAATAAATTATGATGGTAATAATTGAGTGCCACATCATATTGTTAATCAA
ATTATAAATAATTATAAAGACAGGCACAAATATATAAAATATGAGTAAAA
TCACTGGGTCAGATGTTACTTGTGCACAAATGAACACTCATACTTTACCC
CGCCCATGCTTGTAATGACGCTTTCGGTAAAGCCGCTGTGTTAAGAAGTA
TTTAATGACTAGAATGAGAATAATAAAAGATAATATGTACAGGAGGCTTA
ACATTCCGATATCCAGGTTGGAGAAAGGGCTTGCTGCAGTTGCAGCTGAT
CTAGCTCTTCTTGTGTCACGAATGTTCCCTGCACCATAAACACTTTGCAG
ATACTGGTAGACCGCTGGCAAGTTCCAAGCACCTCTCGCTAGCCTACACT
CGGGACATCTAGTTACACTTGGAAACTGAATCTTTGGATACTCTGGATCC
TCCGTCACATCACCGGCAAGTCTTAAATTCACTTCATTATGTGATATCCA
TAACCATAGCACAGCTTTGTCATTTTCTTTTACATCAAATAATCTGTTTC
GAGCAGCCATAGCCTGAAAGTGTTCTGAACAAGTAGTGCATCCAAAAAAG
TGTTTTACGTAACCATGCATCACTCTTAAAACTCTTGGCCCTTCGTTGCC
AGGCTTAAGTGCAGCATTAACAGTCAGTGTGTGAAATAGGGTCCATAAGC
CACAGGTATAACCTCGATATTTTGACTGACTTCCCTTGCATCCGATATAT
TCTAATTGTGACATGTAGACTGGTGCATGGACAGTTTCTAATCGCTTCAC
AATTTCGTAAATATCATTTCCATTCCACTCACTTCTGGTACGAAGTGTAT
CATGTATATTTTCAATATATTCTTTGAGATTGTTGTTTTTGAATGGGAAT
AAGGTTTTCAGGACATATAAGTAATCTAAAAGAACAGTCAAAGGTTCTCC
TGTTAGGCTTTTATATCTTGTAATTTCAGTATTTAAACTTGTTTTCAGTG
TCTTTTCTAGGTCACTGTAGTATACAGCATCGGAGTGAGTTGAAGTTAAT
TTCTCATCTGAGTGATCATTATGAATCATTTCCAGCTCAGGTGTGTCACG
TGTGGGGAAAACATAATTTTTCGACTTCAAAAATGTGTTCACAGCTGCCA
ATAGATTTTGCTTAGTTGGATTTTTTGGAGTAAGCGAATTAGCATCCAAC
ATGGAACTTACAGCAACAAGGCCCGGAAAGTGGCTGACACCTGCTGTGTT
TGCCAACTCACTAGTATCAAAAACTCTTTTTACTTTTATGTGGTTATAAT
CATTTATATCCAATGCAAGTTCTGATCCAACAGTTGAGTTTTCATTTTCA
AATACTAAAAATGTATAGATTACATCATTTGGAACATCATCAAGAACTGA
AGCATAAGAAGCATATGATGCAATAGACAATTTGGGCGCAAATCTCATCC
TGCCCAGAGTCTGTTCCTGCTGCAATTTGGTGATTATTTGAGCCTTCAGT
TTTTCTGCAGTGTCAGTCATTTGAATACGATCACCCACATTGTGGTTTGC
TTTCACATAATGCTCATGAATGTAACGTAATGAAGGGTAGGCCATGACTT
CAAACTCTCTGCATATCTCATTGTTTTCCTCAATGGAACAGTCCATAACT
TTAAGCTGAATTAAATTTTTCCATGGACCCACTTCAGCTGCTAGAGCCTT
AAATTTTGGGGCAAATCCTCTGCAATGACCGCAGTAGCTGTTATAAAATT
GAACGATTGCTGCATGGTTTTGGCTATACACCTTCTTCTCAAAATTTCGC
TGCGTTAAGATAATAACATGATCTGACTTACTATATAAACCTTGCTCATC
AACATCACCGTCGTTTGCAATCACAGCACAATTTACTATAGAAGGAACTA
GTACAATCGCGATTATACTCCAAAGATTCATGGTCGTTGACAATTACATC
CAAATAAAACCTTGTCCAAATCTTACACAGCACCACAAAGACGACCGCCG
TACGAGCGACGACTAACAACGACTAGCATTGAAAGGAATTATTGGATTAC
TAGGTATATCCAATAGCGATAAAACTGCATACGTCATAGATTCAATGAAA
CATTTTACTTCTTGGACAAATTCTCATAACTTTCGTTGATTACACTACGA
GTAGTTACTACTTTTTTATTCCTAGTGCCTGCAGAACGTAACGCAACGTC
ACTTTTAATGATTTCTATTGGTTCAACAATGGTTTATAAATTTATTTTGA
CCAATTAAAATTAAAAGAACATTTGGTAACAAAACATTTGAGCGACTTAT
GC
back to top

protein sequence of HiSeq10159

>HiSeq10159_p ID=HiSeq10159_p|Name=HiSeq10159|organism=Ostrinia scapulalis|type=polypeptide|length=543bp
MNLWSIIAIVLVPSIVNCAVIANDGDVDEQGLYSKSDHVIILTQRNFEKK
VYSQNHAAIVQFYNSYCGHCRGFAPKFKALAAEVGPWKNLIQLKVMDCSI
EENNEICREFEVMAYPSLRYIHEHYVKANHNVGDRIQMTDTAEKLKAQII
TKLQQEQTLGRMRFAPKLSIASYASYASVLDDVPNDVIYTFLVFENENST
VGSELALDINDYNHIKVKRVFDTSELANTAGVSHFPGLVAVSSMLDANSL
TPKNPTKQNLLAAVNTFLKSKNYVFPTRDTPELEMIHNDHSDEKLTSTHS
DAVYYSDLEKTLKTSLNTEITRYKSLTGEPLTVLLDYLYVLKTLFPFKNN
NLKEYIENIHDTLRTRSEWNGNDIYEIVKRLETVHAPVYMSQLEYIGCKG
SQSKYRGYTCGLWTLFHTLTVNAALKPGNEGPRVLRVMHGYVKHFFGCTT
CSEHFQAMAARNRLFDVKENDKAVLWLWISHNEVNLRLAGDVTEDPEYPK
IQFPSVTRCPECRLARGAWNLPAVYQYLQSVYGAGNIRDXKKS
back to top